DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and UGT71B1

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_188812.1 Gene:UGT71B1 / 821729 AraportID:AT3G21750 Length:473 Species:Arabidopsis thaliana


Alignment Length:455 Identity:99/455 - (21%)
Similarity:153/455 - (33%) Gaps:128/455 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LGLFPHPAISHFKFFHPIMRGLAEAGHSVDVI-----SPFEDKDPPNGYKDH-------LLPP-S 77
            |...|.|.:.|.:....:.:.|..:.:.:.|.     |...|....:.|.:.       |||. .
plant     5 LVFIPSPGVGHIRATTALAKLLVASDNRLSVTLIVIPSRVSDDASSSVYTNSEDRLRYILLPARD 69

  Fly    78 TLTDTISLEDFERPYSFLFHYVEFFILHKMGREDCNTTLHSRALTEILKNPPGYYDVILLEQFNT 142
            ..||.:|..|.::|      .|...:....|  |.:|...||...            |:::.|.|
plant    70 QTTDLVSYIDSQKP------QVRAVVSKVAG--DVSTRSDSRLAG------------IVVDMFCT 114

  Fly   143 DCAMSVAHVFQ-APVIGMSSCALMPWHYERFGAPLIPSYISALFQGQS--------------QEM 192
            . .:.:|..|. :..|..:|.|               ||:...|..||              .||
plant   115 S-MIDIADEFNLSAYIFYTSNA---------------SYLGLQFHVQSLYDEKELDVSEFKDTEM 163

  Fly   193 SFAGRLGNWITVHSLNLLYKMFTVPAGNALIRQRFGPGLPSTEDLVRNTSLMLVN-------QHF 250
            .|        .|.:|...:....:|  :.::.:::.|.:.......|.|..:|||       |..
plant   164 KF--------DVPTLTQPFPAKCLP--SVMLNKKWFPYVLGRARSFRATKGILVNSVADMEPQAL 218

  Fly   251 SL----SGPKPLPPNVIEVGGVHISPPKPLPSD---------LQKILDNAPKGVILISWGSQLKA 302
            |.    :|...:|| |..||     |...|.|.         |..:.:...|.|:.:.:|| :..
plant   219 SFFSGGNGNTNIPP-VYAVG-----PIMDLESSGDEEKRKEILHWLKEQPTKSVVFLCFGS-MGG 276

  Fly   303 CSLSAARRDGIVKAIGRLEQEVIWKYEN----DTLPNKPP----NLH----------------IR 343
            .|...||.  |..|:.|.....:|....    ....|.||    ||.                |.
plant   277 FSEEQARE--IAVALERSGHRFLWSLRRASPVGNKSNPPPGEFTNLEEILPKGFLDRTVEIGKII 339

  Fly   344 KWLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLNIAALVQRGMALQLELKK 408
            .|.||.|:|..|.:..|::|.|.....|::...||:...|||.:|..|...:|.. :.|..|:||
plant   340 SWAPQVDVLNSPAIGAFVTHCGWNSILESLWFGVPMAAWPIYAEQQFNAFHMVDE-LGLAAEVKK 403

  Fly   409  408
            plant   404  403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 99/455 (22%)
UGT71B1NP_188812.1 Glycosyltransferase_GTB_type 1..473 CDD:299143 99/455 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.