DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and UGT84A2

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_188793.1 Gene:UGT84A2 / 821710 AraportID:AT3G21560 Length:496 Species:Arabidopsis thaliana


Alignment Length:340 Identity:83/340 - (24%)
Similarity:130/340 - (38%) Gaps:101/340 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LHKMGREDCNTTLHSRALTEILKNPPGYYDVILLEQFNTDCAMSVAHVFQAP--VIGMSSCALMP 166
            |..:|:.:....:  :...|:.|.|.    ..|:..........||...|.|  |:.:.|||.:.
plant    99 LELVGKREIKNLV--KRYKEVTKQPV----TCLINNPFVSWVCDVAEDLQIPCAVLWVQSCACLA 157

  Fly   167 WHY-------------------ERFGAPL-----IPSYI------SALFQGQSQEMSFAGRLGNW 201
            .:|                   :..|.||     |||:|      |||.:               
plant   158 AYYYYHHNLVDFPTKTEPEIDVQISGMPLLKHDEIPSFIHPSSPHSALRE--------------- 207

  Fly   202 ITVHSLNLLYKMFT--VPAGNALIRQRFGPGLPSTEDLVRNTSLMLVNQHFSLSGP-KPLPP--- 260
            :.:..:..|:|.|:  :...|:|           .:|::.:.|.:      ||.|. :||.|   
plant   208 VIIDQIKRLHKTFSIFIDTFNSL-----------EKDIIDHMSTL------SLPGVIRPLGPLYK 255

  Fly   261 ----NVIEVGGVHISPPKPLPSDLQKILDNAP-KGVILISWGSQLKACSLSAARRDGIVKAIGRL 320
                ...:|..|:||.|   .....:.||:.| ..|:.||:|:   ...|...:.|.|  |.|.|
plant   256 MAKTVAYDVVKVNISEP---TDPCMEWLDSQPVSSVVYISFGT---VAYLKQEQIDEI--AYGVL 312

  Fly   321 -----------EQEVIWKYENDTLPNKPPNL-HIRKWLPQRDILAHPNLKVFMSHGGLMGTTEAV 373
                       :||:.:..|...||.:.... .|.:|..|..:|:||::..|::|.|...|.|||
plant   313 NADVTFLWVIRQQELGFNKEKHVLPEEVKGKGKIVEWCSQEKVLSHPSVACFVTHCGWNSTMEAV 377

  Fly   374 SSAVPIVGVPIYGDQ 388
            ||.||.|..|.:|||
plant   378 SSGVPTVCFPQWGDQ 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 83/340 (24%)
UGT84A2NP_188793.1 Glycosyltransferase_GTB-type 1..485 CDD:415824 83/340 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.