DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and AT2G30150

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001323694.1 Gene:AT2G30150 / 817567 AraportID:AT2G30150 Length:456 Species:Arabidopsis thaliana


Alignment Length:157 Identity:45/157 - (28%)
Similarity:72/157 - (45%) Gaps:16/157 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 DLQKILDNAPK-GVILISWGSQLKACSLSAARRDGIVKAIGRLEQEVIWKYENDTLPNKPP---N 339
            |..|.||..|: .|:.||.||.|   |:|.|:.:.||..:.....:..|......|..|..   :
plant   259 DYFKWLDEQPESSVLYISQGSFL---SVSEAQMEEIVVGVREAGVKFFWVARGGELKLKEALEGS 320

  Fly   340 LH-IRKWLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLNIAALVQR---GM 400
            |. :..|..|..:|.|..:..|.:|.|...|.|.:.|.||::..|::.||.||...:|:.   ||
plant   321 LGVVVSWCDQLRVLCHAAIGGFWTHCGYNSTLEGICSGVPLLTFPVFWDQFLNAKMIVEEWRVGM 385

  Fly   401 AL----QLELKKLDENTVYEALTKALD 423
            .:    |:||..:.:. :.|.:.:.:|
plant   386 GIERKKQMELLIVSDE-IKELVKRFMD 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 45/157 (29%)
AT2G30150NP_001323694.1 PLN02448 11..456 CDD:215247 45/157 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.