DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and UGT87A2

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_180575.1 Gene:UGT87A2 / 817566 AraportID:AT2G30140 Length:455 Species:Arabidopsis thaliana


Alignment Length:219 Identity:54/219 - (24%)
Similarity:85/219 - (38%) Gaps:42/219 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 GPGLPSTEDLVRNTSLMLVNQHFSLSGPKPLPPNVIEVGGVHISPPKPLPSDLQKILDNAPKG-V 291
            ||.:|..|..|:|.:               ..||.|:                  .|:..|:| |
plant   240 GPLIPFEELSVQNDN---------------KEPNYIQ------------------WLEEQPEGSV 271

  Fly   292 ILISWGSQLKACSLSAARRDGIVKAIGRLEQEVIWKYENDTLPNKPP---NLH-IRKWLPQRDIL 352
            :.||.||.|   |:|.|:.:.|||.:.......:|......|..|..   :|. :..|..|..:|
plant   272 LYISQGSFL---SVSEAQMEEIVKGLRESGVRFLWVARGGELKLKEALEGSLGVVVSWCDQLRVL 333

  Fly   353 AHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLNIAALVQR-GMALQLELKKLDENTVYE 416
            .|..:..|.:|.|...|.|.:.|.||::..|::.||.||...:|:. .:.:::|..|.:|..:..
plant   334 CHKAVGGFWTHCGFNSTLEGIYSGVPMLAFPLFWDQILNAKMIVEDWRVGMRIERTKKNELLIGR 398

  Fly   417 ALTKALDPSFKARAKEVASSYNNR 440
            ...|.:...|..|..|.......|
plant   399 EEIKEVVKRFMDRESEEGKEMRRR 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 54/219 (25%)
UGT87A2NP_180575.1 PLN02448 2..455 CDD:215247 54/219 (25%)
YjiC 13..450 CDD:224732 54/219 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.