DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and AT2G28080

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_180375.1 Gene:AT2G28080 / 817352 AraportID:AT2G28080 Length:482 Species:Arabidopsis thaliana


Alignment Length:130 Identity:32/130 - (24%)
Similarity:54/130 - (41%) Gaps:21/130 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 SDLQKILDNAPK-GVILISWGSQLKACSLSAARRDGIVKAIGRLEQEV--IWKYENDTLPNKPPN 339
            ||..:.|:..|| .|:.||:||.     ....::|.:..|.|.|..:|  :|....|.:.:...|
plant   276 SDCTQWLNTKPKSSVLYISFGSY-----AHVTKKDLVEIAHGILLSKVNFVWVVRPDIVSSDETN 335

  Fly   340 L-------------HIRKWLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLN 391
            .             .:..|..|..:|:|.::..|::|.|.....|.:...||::..|:..||..|
plant   336 PLPEGFETEAGDRGIVIPWCCQMTVLSHESVGGFLTHCGWNSILETIWCEVPVLCFPLLTDQVTN 400

  Fly   392  391
            plant   401  400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 32/130 (25%)
AT2G28080NP_180375.1 Glycosyltransferase_GTB_type 22..468 CDD:299143 32/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.