DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and UGT84B1

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_179907.1 Gene:UGT84B1 / 816858 AraportID:AT2G23260 Length:456 Species:Arabidopsis thaliana


Alignment Length:360 Identity:85/360 - (23%)
Similarity:137/360 - (38%) Gaps:91/360 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 LLEQFNTDCAMSVAHVFQAPVIGMS---SCALMPWHYERFGAPLIPSYISALFQGQSQEMSFAG- 196
            ::|:....|.:|.......|.:..|   |||:: | .:..||      .|..::...:..||.. 
plant    98 IIEEKRYSCIISSPFTPWVPAVAASHNISCAIL-W-IQACGA------YSVYYRYYMKTNSFPDL 154

  Fly   197 -RLGNWITVHSLNLL----YKMFTVPAGNALIRQRFGPGLPSTEDLVRNTSLMLVNQHF------ 250
             .|...:.:.:|.||    ...|.:|:|.|    .|...:....|.:|....:|||..:      
plant   155 EDLNQTVELPALPLLEVRDLPSFMLPSGGA----HFYNLMAEFADCLRYVKWVLVNSFYELESEI 215

  Fly   251 --SLSGPKPLPPNVIEVGGVHISPPKPLPSDL------QKILD-------------------NAP 288
              |::..||    ||.:|        ||.|..      ::.||                   .|.
plant   216 IESMADLKP----VIPIG--------PLVSPFLLGDGEEETLDGKNLDFCKSDDCCMEWLDKQAR 268

  Fly   289 KGVILISWGSQLKACSLSAARRDGIVKAIGRLEQEVIW------KYENDTLPN---KPPNLHIRK 344
            ..|:.||:||.|:......   :.|.||:.......:|      |.:|..:..   |.....:.:
plant   269 SSVVYISFGSMLETLENQV---ETIAKALKNRGLPFLWVIRPKEKAQNVAVLQEMVKEGQGVVLE 330

  Fly   345 WLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLNIAALV--------QRGMA 401
            |.||..||:|..:..|::|.|...|.|.|.:.||:|..|.:.||.::...||        .|..:
plant   331 WSPQEKILSHEAISCFVTHCGWNSTMETVVAGVPVVAYPSWTDQPIDARLLVDVFGIGVRMRNDS 395

  Fly   402 LQLELKKLDENTVYEALTK---ALDPSFKARAKEV 433
            :..|||..:.....||:|:   |:|  .:.||.|:
plant   396 VDGELKVEEVERCIEAVTEGPAAVD--IRRRAAEL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 85/360 (24%)
UGT84B1NP_179907.1 PLN02210 1..456 CDD:215127 85/360 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.