DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and UGT84B2

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_179906.1 Gene:UGT84B2 / 816857 AraportID:AT2G23250 Length:438 Species:Arabidopsis thaliana


Alignment Length:401 Identity:93/401 - (23%)
Similarity:148/401 - (36%) Gaps:114/401 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 LLEQFNTDCAMSVAHVFQAPVIGMS---SCALMPWHYERFGAPLIPSYISALFQGQSQEMSFAGR 197
            ::|:...||.:||......|.:..:   .||:: | .:..||      .|..::...:...|.  
plant    85 IIEEKRFDCIISVPFTPWVPAVAAAHNIPCAIL-W-IQACGA------FSVYYRYYMKTNPFP-- 139

  Fly   198 LGNWITVHSLNLLYKMFTVPAGNALIRQRFGPG--LPST-----------EDLVRNTSLMLVNQH 249
                 .:..||...::..:|    |:..|..|.  |||.           .|.:::...:|||..
plant   140 -----DLEDLNQTVELPALP----LLEVRDLPSLMLPSQGANVNTLMAEFADCLKDVKWVLVNSF 195

  Fly   250 F--------SLSGPKPLPPNVIEVGGVHISP---PKPLPSDLQKILD--------------NAPK 289
            :        |:|..||:.|         |.|   |..|.:|.:|.||              .|..
plant   196 YELESEIIESMSDLKPIIP---------IGPLVSPFLLGNDEEKTLDMWKVDDYCMEWLDKQARS 251

  Fly   290 GVILISWGSQLKACSLSAARRDGIVKAIGRLEQEVIW------KYENDTLPN---KPPNLHIRKW 345
            .|:.||:||.||:.....   :.|..|:.......:|      |.||..:..   |.....:.:|
plant   252 SVVYISFGSILKSLENQV---ETIATALKNRGVPFLWVIRPKEKGENVQVLQEMVKEGKGVVTEW 313

  Fly   346 LPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLNIAALV--------QRGMAL 402
            ..|..||:|..:..|::|.|...|.|.|.:.||:|..|.:.||.|:...||        .:..|:
plant   314 GQQEKILSHMAISCFITHCGWNSTIETVVTGVPVVAYPTWIDQPLDARLLVDVFGIGVRMKNDAI 378

  Fly   403 QLELKKLDENTVYEALTK---ALDPSFKARAKEVASSYNNRIQGPLETAIWWVEHVAETKGAPLT 464
            ..|||..:.....||:|:   |.|  .:.||.|                   ::|.|.:..:| .
plant   379 DGELKVAEVERCIEAVTEGPAAAD--MRRRATE-------------------LKHAARSAMSP-G 421

  Fly   465 QPSAVHLSRFV 475
            ..||.:|..|:
plant   422 GSSAQNLDSFI 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 88/384 (23%)
UGT84B2NP_179906.1 PLN02210 1..438 CDD:215127 93/401 (23%)
YjiC 8..420 CDD:224732 88/386 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.