DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and AT2G23210

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001318272.1 Gene:AT2G23210 / 816853 AraportID:AT2G23210 Length:287 Species:Arabidopsis thaliana


Alignment Length:308 Identity:62/308 - (20%)
Similarity:102/308 - (33%) Gaps:99/308 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 FQGQSQEM-SFAGRLGNWITVHSLNLLYKMFTVPAGNALIRQR-----------FGPGLPS---- 233
            |||....| .||..|..      .||.:.:.|:.:...|:...           |..|||.    
plant    18 FQGHLNPMLKFAKHLAR------TNLHFTLATIESARDLLSSTDEPHSLVDLVFFSDGLPKDDPR 76

  Fly   234 -----TEDL----VRNTSLMLVNQHFSLSGPKPLPPNVIEVGGVHISPPKPLPSDLQKILDNAPK 289
                 ||.|    ..|.|.::..:.|......|..|.|..|...|                |.|.
plant    77 DHEPLTESLRKVGANNFSKIIEGKRFDCIISVPFTPWVPAVAAAH----------------NIPC 125

  Fly   290 GVILISWGSQLKACSLSAARRDGIVKAIGRLEQEVIWKY--ENDTLPN-KPPNLHIRKWLPQRDI 351
            .::   |   ::||:       |.         .|.::|  :.::.|: :.||..:.  ||....
plant   126 AIL---W---IEACA-------GF---------SVYYRYYMKTNSFPDLEDPNQKVE--LPGLPF 166

  Fly   352 LAHPNLKVFM--SHGGLMGT-----TEAVSSAVPIVGVPIYGDQSL------NIAALVQRGMALQ 403
            |...:|...|  |||.:..|     .|.:.....::....|..:|:      ::..::..|..:.
plant   167 LEVRDLPTLMLPSHGAIFNTLMAEFVECLKDVKWVLANSFYELESVIIESMFDLKPIIPIGPLVS 231

  Fly   404 LELKKLDENTVYEA----LTKALDPSFKARAKEVASS--------YNN 439
            ..|...||:.:.:.    :.||.|...:...|:|.||        |:|
plant   232 PFLLGADEDKILDGKSLDMWKADDYCMEWLDKQVRSSVFTYLSEAYSN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 62/308 (20%)
AT2G23210NP_001318272.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.