DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and AT2G18570

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_849978.2 Gene:AT2G18570 / 816372 AraportID:AT2G18570 Length:470 Species:Arabidopsis thaliana


Alignment Length:272 Identity:59/272 - (21%)
Similarity:114/272 - (41%) Gaps:68/272 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 RFGPGLPSTEDLVRNT-------SLMLVNQHFSLSGPKPLPPNVIEVGGV-----HISPPKPLPS 278
            |.|..:|.::.::.||       :|..:.:...||....:|  |..:|.:     |:..|.   |
plant   197 RAGLEVPMSDGVLVNTWEELQGNTLAALREDEELSRVMKVP--VYPIGPIVRTNQHVDKPN---S 256

  Fly   279 DLQKILDNAPKGVILISWGS----------QLK-ACSLSAARRDGIVK-------AIGRLEQEVI 325
            ..:.:.:...:.|:.:..||          :|. ...||..|...:::       ||...:::| 
plant   257 IFEWLDEQRERSVVFVCLGSGGTLTFEQTVELALGLELSGQRFVWVLRRPASYLGAISSDDEQV- 320

  Fly   326 WKYENDTLP------NKPPNLHIRKWLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPI 384
                :.:||      .:...:.:.:|.||.:||:|.::..|:||.|.....|:::..|||:..|:
plant   321 ----SASLPEGFLDRTRGVGIVVTQWAPQVEILSHRSIGGFLSHCGWSSALESLTKGVPIIAWPL 381

  Fly   385 YGDQSLNIAALVQR-GMALQL-EL---KKLDENTVYEALTKAL------DPSFKARAKEV----- 433
            |.:|.:|...|.:. |:|::. ||   :.:....|...:.|.:      ....:|:|:||     
plant   382 YAEQWMNATLLTEEIGVAVRTSELPSERVIGREEVASLVRKIMAEEDEEGQKIRAKAEEVRVSSE 446

  Fly   434 ------ASSYNN 439
                  .||||:
plant   447 RAWSKDGSSYNS 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 59/272 (22%)
AT2G18570NP_849978.2 PLN03015 1..470 CDD:178589 59/272 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.