DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and AT2G18560

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_179446.2 Gene:AT2G18560 / 816371 AraportID:AT2G18560 Length:380 Species:Arabidopsis thaliana


Alignment Length:329 Identity:70/329 - (21%)
Similarity:116/329 - (35%) Gaps:120/329 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 FGPGLPSTEDLVRNTSLMLVNQH---FSLSGPKPLPPNVIEVGGVHISPPKPLPSD--------L 280
            ||..|.|..|:...:..:.:..|   .:|....|:...|:|...|.|..|..:|..        |
plant    27 FGTALLSITDVGVTSKYVYIPSHAWFLALIVYLPVLDKVMEGEYVDIKEPMKIPGCKPVGPKELL 91

  Fly   281 QKILDNAPK----------------GVILISWGSQLKACSLSAARRD----GIVKA----IGRL- 320
            ..:||.:.:                ||::.:|| :|:..:|:|.|.|    .::|.    ||.: 
plant    92 DTMLDRSDQQYRDCVQIGLEIPMSDGVLVNTWG-ELQGKTLAALREDIDLNRVIKVPVYPIGPIV 155

  Fly   321 -------------------------------------EQ--EVIWKYE----------------- 329
                                                 ||  |:.|..|                 
plant   156 RTNVLIEKPNSTFEWLDKQEERSVVYVCLGSGGTLSFEQTMELAWGLELSCQSFLWVLRKPPSYL 220

  Fly   330 ----------NDTLP------NKPPNLHIRKWLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVP 378
                      :|.||      .:...|.:.:|.||.:||:|.::..|:||.|.....|:::..||
plant   221 GASSKDDDQVSDGLPEGFLDRTRGVGLVVTQWAPQVEILSHRSIGGFLSHCGWSSVLESLTKGVP 285

  Fly   379 IVGVPIYGDQSLNIAALVQR-GMAL---QLELKKLDENTVYEALTKAL-------DPSFKARAKE 432
            |:..|:|.:|.:|...|.:. |||:   :|..||:.......:|.|.:       ....|.:|:|
plant   286 IIAWPLYAEQWMNATLLTEEIGMAIRTSELPSKKVISREEVASLVKKIVAEEDKEGRKIKTKAEE 350

  Fly   433 VASS 436
            |..|
plant   351 VRVS 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 70/329 (21%)
AT2G18560NP_179446.2 Glycosyltransferase_GTB_type 1..380 CDD:299143 70/329 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.