DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and UGT73B4

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_179151.2 Gene:UGT73B4 / 816041 AraportID:AT2G15490 Length:484 Species:Arabidopsis thaliana


Alignment Length:525 Identity:121/525 - (23%)
Similarity:178/525 - (33%) Gaps:180/525 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 HFKFFHPIMRGLAEAGHSV---DVISPFEDKDPPNGYKDHLLPPSTLTDTISLEDFERPYSFLFH 97
            |..|| |.|    ..||.:   |:...|..:    |.|..|     ||..|:.:..|:|      
plant     7 HILFF-PFM----AHGHMIPLLDMAKLFARR----GAKSTL-----LTTPINAKILEKP------ 51

  Fly    98 YVEFFILH----KMGREDCNTTLHSRALTEILKN--------PPGYYDVIL------------LE 138
             :|.|.:.    ::|.:..|.......|.|..:|        ....:|:.|            ||
plant    52 -IEAFKVQNPDLEIGIKILNFPCVELGLPEGCENRDFINSYQKSDSFDLFLKFLFSTKYMKQQLE 115

  Fly   139 QF--NTDCAMSVAHVFQAPVIGMSSCALMPW---HYERFGAPLIPSYISALFQGQSQEMSFAGRL 198
            .|  .|..:..||.:|            .||   ..|:.|.|.:      :|.|.|   |||...
plant   116 SFIETTKPSALVADMF------------FPWATESAEKIGVPRL------VFHGTS---SFALCC 159

  Fly   199 GNWITVHSLNLLYKMFTVPAGNALIRQRFGPGLPS----TEDLVRNTSL---------------- 243
            ...:.:|..:......:.|   .:|     ||||.    |||....|:.                
plant   160 SYNMRIHKPHKKVASSSTP---FVI-----PGLPGDIVITEDQANVTNEETPFGKFWKEVRESET 216

  Fly   244 ----MLVNQHFSL-SGPKPLPPNVIEVGGVHISP--------------PKPLPSDLQKIL----D 285
                :|||..:.| |.......:.:.....||.|              .|....|.|:.|    .
plant   217 SSFGVLVNSFYELESSYADFYRSFVAKKAWHIGPLSLSNRGIAEKAGRGKKANIDEQECLKWLDS 281

  Fly   286 NAPKGVILISWGSQLKACSLSAARRDGIVKAIGRLE---QEVIW---KYEN--------DTLP-- 334
            ..|..|:.:|:||.      :....:.:::....||   |..||   |.||        |.||  
plant   282 KTPGSVVYLSFGSG------TGLPNEQLLEIAFGLEGSGQNFIWVVSKNENQVGTGENEDWLPKG 340

  Fly   335 ----NKPPNLHIRKWLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQ------- 388
                ||...|.||.|.||..||.|..:..|::|.|...|.|.:::.:|:|..|:..:|       
plant   341 FEERNKGKGLIIRGWAPQVLILDHKAIGGFVTHCGWNSTLEGIAAGLPMVTWPMGAEQFYNEKLL 405

  Fly   389 ------SLNIAA--LVQRGMALQLELKKLDENTVYEAL-----------TKALDPSFKARAKEVA 434
                  .:|:.|  ||::|   :|..:...|..|.|.:           .|.|....||..:|..
plant   406 TKVLRIGVNVGATELVKKG---KLISRAQVEKAVREVIGGEKAEERRLRAKELGEMAKAAVEEGG 467

  Fly   435 SSYNN 439
            ||||:
plant   468 SSYND 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 121/525 (23%)
UGT73B4NP_179151.2 PLN03007 1..484 CDD:178584 121/525 (23%)
YjiC 7..465 CDD:224732 116/516 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.