DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and Ugt3a2

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_038959826.1 Gene:Ugt3a2 / 294793 RGDID:1564365 Length:454 Species:Rattus norvegicus


Alignment Length:481 Identity:124/481 - (25%)
Similarity:220/481 - (45%) Gaps:75/481 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 DTISLEDFERPYSFLFHY-------------VEF-----FILHKMGREDCNTTLHSRALTEILKN 127
            :|.|:|. ..|.:.:.||             ::|     ..:|:...:.||..|..:.:.|.|||
  Rat     3 ETFSIEK-SHPGNRIMHYRVDLCPQKVKLNKLQFEHHTIVKIHRHFGDLCNHLLSRKDIMEFLKN 66

  Fly   128 PPGYYDVILLEQFNTDCAMSVAHVFQAPVIGMS-SCALMPWHYERFGAPLIPSYISALFQGQSQE 191
              ..:|::|.|..:...::.|..:.:..|:.:: ....|.:..:|  .||  ||:.....|.:.:
  Rat    67 --ANFDLVLFESVDYCSSLIVEKLGKQFVLFLAFQLGFMDFELQR--VPL--SYVPVYGSGLTDQ 125

  Fly   192 MSFAGRLGNWITVHSLNLLYKMFTVPAGNALIRQRFGPG-LPSTEDLVRNTSLMLVNQHFSLSGP 255
            |.|.||:.|::....|:...:.. :...::.|::.|..| .|...||:....|..||..|:....
  Rat   126 MDFWGRVKNFLMFFDLSRKQREI-LSQYDSTIQEHFAEGSRPVLSDLLLKAELWFVNCDFAFEFA 189

  Fly   256 KPLPPNVIEVGGVHISPPKPLPSDLQKILDN-APKGVILISWGS-----QLKACSLSAARRDGIV 314
            :||.||::.|||:...|.:.:|.||:..:.. ...|.:|::.|:     |.|.          |:
  Rat   190 RPLFPNIVYVGGLLDKPVQSIPQDLENFITQFGDSGFVLVALGTVATKFQTKE----------II 244

  Fly   315 K----AIGRLEQEVIWKYENDTLPNK---PPNLHIRKWLPQRDILAHPNLKVFMSHGGLMGTTEA 372
            |    |...|.|.|||..::...|..   .||:.|..||||.|:||||::::|::|||:....||
  Rat   245 KEMNNAFAHLPQGVIWACKDSHWPKDVTLAPNVKIMDWLPQTDLLAHPSIRLFVTHGGMNSVNEA 309

  Fly   373 VSSAVPIVGVPIYGDQSLNIAALVQRGMALQLELKKLDENTVYEALTKAL-DPSFKARA---KEV 433
            :...||:||:..:.||..|:..:..:.:.:.::::.|...|....:.:.: |..:|:.|   |.:
  Rat   310 IQHGVPMVGILFFSDQPENMIRVEAKTIGVSIQIQTLKAETFARTMKEVIEDKRYKSAAMASKII 374

  Fly   434 ASSY----NNRIQGPLETAIWWVEHVAETKGAPLTQPSAVHLSRFVYYSLDVYSVVALSLLLPVI 494
            ..|:    :.|::|       |::|:.:|.||...:|.|........|.|||: :..|.|.|..:
  Rat   375 RHSHPLTPSQRLEG-------WIDHILQTGGAAHLKPYAFQQPWHEQYLLDVF-LFLLGLTLGTV 431

  Fly   495 TL----LGLIRMFKRREPKGDRKLKR 516
            .|    ||.:    .|...|.||.|:
  Rat   432 WLCVKVLGAV----MRYLSGARKAKQ 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 105/419 (25%)
Ugt3a2XP_038959826.1 Glycosyltransferase_GTB-type 49..419 CDD:415824 103/393 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344003
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.