DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and Y43D4A.2

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_502984.3 Gene:Y43D4A.2 / 189851 WormBaseID:WBGene00012788 Length:151 Species:Caenorhabditis elegans


Alignment Length:96 Identity:24/96 - (25%)
Similarity:40/96 - (41%) Gaps:16/96 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 CNTTLHSRALTEILKNPPGYYDVILLEQFNTDCAMSV-------AHVFQAPVIGMSSCALMPWHY 169
            |...|..:.|.|.|:  ...:|:.:.|.|:| ||.::       |||      .:.||:.:....
 Worm    23 CRKVLEDKELIERLR--AENFDLAITEPFDT-CANALFEAIKIRAHV------AVLSCSRLDHVS 78

  Fly   170 ERFGAPLIPSYISALFQGQSQEMSFAGRLGN 200
            :..|.|:.|||:........:.|:...|..|
 Worm    79 KAIGQPIAPSYLPGTQSTHGERMTIWQRFMN 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 24/96 (25%)
Y43D4A.2NP_502984.3 UDPGT 14..>120 CDD:278624 24/96 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161375
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.