DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and AT1G05675

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001184915.1 Gene:AT1G05675 / 10723139 AraportID:AT1G05675 Length:453 Species:Arabidopsis thaliana


Alignment Length:446 Identity:98/446 - (21%)
Similarity:151/446 - (33%) Gaps:159/446 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LFPHPAISHFKFFHPIMRGLAEAGHSVDVISPFEDKDPPNGYKDHLLPPSTLTDTISL------- 85
            :.|.||..|........:.||.....:.::...:...||  ||       |..|||::       
plant     9 VLPFPAQGHITPMSQFCKRLASKSLKITLVLVSDKPSPP--YK-------TEHDTITVVPISNGF 64

  Fly    86 -EDFERPYSFLFHYVEFFILHKMGREDCNTTLHSRALTEILK---NPPG--YYDVILLEQFNTDC 144
             |..||... |..|:|        |.:.:.......|.|.:|   |||.  .||..:      ..
plant    65 QEGQERSED-LDEYME--------RVESSIKNRLPKLIEDMKLSGNPPRALVYDSTM------PW 114

  Fly   145 AMSVAHVFQAPVIGMSSCAL--MPW-----HYERF-GAPLIPS--YISALFQGQSQEMSF----- 194
            .:.|||.:     |:|....  .||     :|..| |:..:||  |      |.|...||     
plant   115 LLDVAHSY-----GLSGAVFFTQPWLVSAIYYHVFKGSFSVPSTKY------GHSTLASFPSLPI 168

  Fly   195 --AGRLGNWITVHSLNLLYKMFTV---------------------------------PAGNALIR 224
              |..|.::: ..|.:..|.:.||                                 |..|    
plant   169 LNANDLPSFL-CESSSYPYILRTVIDQLSNIDRVDIVLCNTFDKLEEKLLKWIKSVWPVLN---- 228

  Fly   225 QRFGPGLPS-------TEDLVRNTSLMLVNQHFSLSGPKPLPPNVIEVGGVHISPPKPLPSDLQK 282
              .||.:||       .||         .|..|||.|.|                   :...::.
plant   229 --IGPTVPSMYLDKRLAED---------KNYGFSLFGAK-------------------IAECMEW 263

  Fly   283 ILDNAPKGVILISWGSQLKACSLSAARRDGIVKAIGRLEQE---VIWKYENDTLPNKPPNLHIRK 344
            :....|..|:.:|:|      ||...::|.:::....|:|.   .:| ...:|...|.|..:|.:
plant   264 LNSKQPSSVVYVSFG------SLVVLKKDQLIELAAGLKQSGHFFLW-VVRETERRKLPENYIEE 321

  Fly   345 ---------WLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLN 391
                     |.||.::|.|.::..|::|.|...|.|.:|..||::|:|.:.||..|
plant   322 IGEKGLTVSWSPQLEVLTHKSIGCFVTHCGWNSTLEGLSLGVPMIGMPHWADQPTN 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 98/446 (22%)
AT1G05675NP_001184915.1 Glycosyltransferase_GTB-type 6..450 CDD:415824 98/446 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.