DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and UGT89B1

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_177529.2 Gene:UGT89B1 / 843725 AraportID:AT1G73880 Length:473 Species:Arabidopsis thaliana


Alignment Length:450 Identity:90/450 - (20%)
Similarity:156/450 - (34%) Gaps:148/450 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LFPHPGVSH----FHFFH---------------------PIMKGLAEAGHDVS-VVSHFPDKHP- 70
            :||.|...|    ..|.|                     |.:..|..|..::. ::..|| .|| 
plant    17 IFPFPAQGHMIPLLDFTHRLALRGGAALKITVLVTPKNLPFLSPLLSAVVNIEPLILPFP-SHPS 80

  Fly    71 ----VAHYKDFPLTGMDKLTNSV-DLKFFEKRTFYSH-------FQEFFLLYDWGKQTCNLTLRS 123
                |.:.:|.|.:|...:.::: :|.........||       ..:|||  .|.|   ||.:  
plant    81 IPSGVENVQDLPPSGFPLMIHALGNLHAPLISWITSHPSPPVAIVSDFFL--GWTK---NLGI-- 138

  Fly   124 EALQQILRRPGRFDVIIMEQFNTDCMMGVAHQLQAPVIALSSCVM------MPWHY------ERM 176
                      .|||.                   :|..|::.|::      ||...      |.:
plant   139 ----------PRFDF-------------------SPSAAITCCILNTLWIEMPTKINEDDDNEIL 174

  Fly   177 GAPLIPS-------HIPALFMAQSQHMNFGGRLANWFSTHALNWMYKLLSVPAADAM----VQYK 230
            ..|.||:       .|.:|:.:..........:.:.|..:..:|...:.|..|.:.:    ::.:
plant   175 HFPKIPNCPKYRFDQISSLYRSYVHGDPAWEFIRDSFRDNVASWGLVVNSFTAMEGVYLEHLKRE 239

  Fly   231 FGHD-VPSVGELVKNTSMFFVNQHYSLSGPKVTPPNVIELGGIHIQKSKPLPADLQRILDNAEEG 294
            .||| |.:||.::            .|||.....|..:.:.  |:..          .||..|:.
plant   240 MGHDRVWAVGPII------------PLSGDNRGGPTSVSVD--HVMS----------WLDAREDN 280

  Fly   295 -VILISWGSMI---RANSLSAA---KRDGI--IRAVARLKQKVIWKWENETLPN---------QP 341
             |:.:.:||.:   :..:|:.|   ::.|:  |.||....:|      :.|..|         ..
plant   281 HVVYVCFGSQVVLTKEQTLALASGLEKSGVHFIWAVKEPVEK------DSTRGNILDGFDDRVAG 339

  Fly   342 PNMHIMKWLPQRDILCHPNVKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVNTAALVE 401
            ..:.|..|.||..:|.|..|..|::|.|.....||...||.::..||..||:.:.:.:|:
plant   340 RGLVIRGWAPQVAVLRHRAVGAFLTHCGWNSVVEAVVAGVLMLTWPMRADQYTDASLVVD 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 90/449 (20%)
UGT89B1NP_177529.2 PLN02863 4..473 CDD:215465 90/449 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.