DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and UGT78D1

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_564357.1 Gene:UGT78D1 / 839933 AraportID:AT1G30530 Length:453 Species:Arabidopsis thaliana


Alignment Length:256 Identity:52/256 - (20%)
Similarity:98/256 - (38%) Gaps:63/256 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 MYKL-LSVPAADAMVQYKFGHDVPSVGELVKNTSMFFVN-----QHYSLSGPKVTPPN------- 265
            :|:: |::|.|.|:....|....|::...:::....|:|     ...|.|..::..|:       
plant   202 LYQMSLALPRASAVFISSFEELEPTLNYNLRSKLKRFLNIAPLTLLSSTSEKEMRDPHGCFAWMG 266

  Fly   266 --------VIELGGIHIQKSKPLPADLQRILDNAEEGVILISWGSMIRANSLSAAKRDGIIRAVA 322
                    .|..|.:    .:|.|.:|..|....|...:...| |:...|.:...|  |.:   .
plant   267 KRSAASVAYISFGTV----MEPPPEELVAIAQGLESSKVPFVW-SLKEKNMVHLPK--GFL---D 321

  Fly   323 RLKQKVIWKWENETLPNQPPNMHIMKWLPQRDILCHPNVKVFMSHGGLMGTSEAAYCGVPVVATP 387
            |.:::.|                ::.|.||.::|.|..:.|.::|.|.....|:...|||::..|
plant   322 RTREQGI----------------VVPWAPQVELLKHEAMGVNVTHCGWNSVLESVSAGVPMIGRP 370

  Fly   388 MYGDQFVNTAA---------LVERGMGTILNFE----DI---GENTVMRALKKALDKKFHD 432
            :..|..:|..|         :::.|:.|...||    |:   .:...|:|..|.|.:|..:
plant   371 ILADNRLNGRAVEVVWKVGVMMDNGVFTKEGFEKCLNDVFVHDDGKTMKANAKKLKEKLQE 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 52/256 (20%)
UGT78D1NP_564357.1 GT1_Gtf-like 12..432 CDD:340817 52/256 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.