DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and UGT85A7

DIOPT Version :10

Sequence 1:NP_609910.1 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_173652.1 Gene:UGT85A7 / 838841 AraportID:AT1G22340 Length:487 Species:Arabidopsis thaliana


Alignment Length:80 Identity:16/80 - (20%)
Similarity:26/80 - (32%) Gaps:26/80 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VFGHIK--------PID------------SFCFERVDKRLERS----DNAAAYGIAQQMQGNVS- 60
            |..|:|        ||.            .|||..::.:|..|    :..::.......|||.. 
plant    17 VMNHVKGQAKKKRCPIGLHTYGKCGTDRAKFCFSEIESKLSFSKQVLNTISSCRCDDDRQGNKDY 81

  Fly    61 -GQSAVNDGLSFAAQ 74
             |.:.:.:....|.|
plant    82 IGANVIEEKAVLAPQ 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_609910.1 GT1_Gtf-like 28..457 CDD:340817 12/65 (18%)
UGT85A7NP_173652.1 Glycosyltransferase_GTB-type 12..481 CDD:471961 16/80 (20%)

Return to query results.
Submit another query.