DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and Ugt2b35

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001004271.1 Gene:Ugt2b35 / 83808 RGDID:620895 Length:530 Species:Rattus norvegicus


Alignment Length:501 Identity:140/501 - (27%)
Similarity:235/501 - (46%) Gaps:87/501 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SHFHFFHPIMKGLAEAGHDVSVV----SHFPDKHPVAHYKDFPLTGMDKLTNSVDLKFFEKRT-F 99
            ||:.....|::.|.:.||:|:|:    |.|.|....:                 ||||....| |
  Rat    34 SHWMNIKIILEELVQKGHEVTVLRPSASVFLDPKETS-----------------DLKFVTFPTSF 81

  Fly   100 YSH-FQEFFL------LYDWGKQTC-----------------NLTLRSEAL--QQILRR--PGRF 136
            .|| .:.||.      .|:..:.||                 .||:..||:  :|.:.:  ..:|
  Rat    82 SSHDLENFFTRFVNVWTYELPRDTCLSYFLYLQDTIDEYSDYCLTVCKEAVSNKQFMTKLQESKF 146

  Fly   137 DVIIMEQFNTDCMMGVAHQLQAPVIALSSCVMMPWH--YERMGAPLI-PSHIPALFMAQSQHMNF 198
            ||:..:... .|...:|..||.|.  |.|....|.:  .:.:|..|. ||::|.:|...:..|.|
  Rat   147 DVVFSDAIG-PCGELIAELLQIPF--LYSLRFSPGYTIEKYIGGVLFPPSYVPMIFSGLAGQMTF 208

  Fly   199 GGRLAN---------WFST-HALNW--MY-KLLSVPAADAMVQYKFGHDVPSVGELVKNTSMFFV 250
            ..|:.|         ||.| ....|  .| |.|..|.              ::.|::....|:.:
  Rat   209 IERVHNMICMLYFDFWFQTFREKKWDPFYSKTLGRPT--------------TLAEIMGKAEMWLI 259

  Fly   251 NQHYSLSGPKVTPPNVIELGGIHIQKSKPLPADLQRILDNA-EEGVILISWGSMIRANSLSAAKR 314
            ..::.|..|....|||..:||:|.:.:||||.|::..:.:: |.||::.|.|||:|  :::..|.
  Rat   260 RSYWDLEFPHPISPNVDYIGGLHCKPAKPLPKDIEDFVQSSGEHGVVVFSLGSMVR--NMTEEKA 322

  Fly   315 DGIIRAVARLKQKVIWKWENETLPNQPPNMHIMKWLPQRDILCHPNVKVFMSHGGLMGTSEAAYC 379
            :.|..|:|::.|||:|:::.:..|...||..:.|||||.|:|.||..|.|::|||..|..||.:.
  Rat   323 NIIAWALAQIPQKVLWRFDGKKPPTLGPNTRLYKWLPQNDLLGHPKTKAFVTHGGANGIYEAIHH 387

  Fly   380 GVPVVATPMYGDQFVNTAALVERGMGTILNFEDIGENTVMRALKKALDKKFHDAAKVVSHSFHH- 443
            |:|::..|::|:|..|.|.:|.:|....:||..:.::.::.||::.::..|:....:...:.|| 
  Rat   388 GIPMIGIPLFGEQHDNIAHMVAKGAAVEVNFRTMSKSDMLNALEEVINNPFYKKNAMWLSTIHHD 452

  Fly   444 RPQQALHTAIWWVEHVAHTGGAPLLKPSAVEMSRFVYYSLDVYAVL 489
            :|.:.|..|::|:|.|....||..|:.....:..:.|:||||...|
  Rat   453 QPTKPLDRAVFWIEFVMRHKGAKHLRSLGHNLPWYQYHSLDVIGFL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 135/492 (27%)
Ugt2b35NP_001004271.1 UDPGT 24..527 CDD:278624 140/501 (28%)
egt <270..489 CDD:223071 72/220 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343987
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.