DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and AT1G06000

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_563756.1 Gene:AT1G06000 / 837109 AraportID:AT1G06000 Length:435 Species:Arabidopsis thaliana


Alignment Length:377 Identity:85/377 - (22%)
Similarity:145/377 - (38%) Gaps:87/377 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 EALQQILRRPGRFDVIIMEQFNTDCMMGVAHQLQAPVIALSSCVMMPWHYERMGAPLI------- 181
            :||:. |..|..|..:|:...:..|:......||.  :.|.:.|.|.....|:..||:       
plant    52 DALRS-LHSPEHFKTLILPFPSHPCIPSGVESLQQ--LPLEAIVHMFDALSRLHDPLVDFLSRQP 113

  Fly   182 PSHIPALFMAQSQHMNFGGRLANWFSTHALNWM-YKLLSVPAADAMVQYKFGHDV-----PSVG- 239
            ||.:|...:..|....:..::|:.||..::::: ....|:....|.....|.:|:     .|.| 
plant   114 PSDLPDAILGSSFLSPWINKVADAFSIKSISFLPINAHSISVMWAQEDRSFFNDLETATTESYGL 178

  Fly   240 ----------ELVKNTSMFFVNQHYSLS-GPKVTPPNVIELGGIHIQKSKPLPADLQRILDNAEE 293
                      |.|:.....|:|.|...: ||.:.....::.||   |.|.| ||.:...||:..|
plant   179 VINSFYDLEPEFVETVKTRFLNHHRIWTVGPLLPFKAGVDRGG---QSSIP-PAKVSAWLDSCPE 239

  Fly   294 --GVILISWGSMIRANSLSAAKRDGIIRAVARLKQKVIW--------------KWENETLPN--- 339
              .|:.:.:||.||   |:|.:...:..|:.:...:.||              ..|.:.:|.   
plant   240 DNSVVYVGFGSQIR---LTAEQTAALAAALEKSSVRFIWAVRDAAKKVNSSDNSVEEDVIPAGFE 301

  Fly   340 ---QPPNMHIMKWLPQRDILCHPNVKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVNTAALVE 401
               :...:.|..|.||..||.|..|..:::|.|.....|....||.::|.||..|.|.||..:|:
plant   302 ERVKEKGLVIRGWAPQTMILEHRAVGSYLTHLGWGSVLEGMVGGVMLLAWPMQADHFFNTTLIVD 366

  Fly   402 RGMGTILNFEDIGEN--------------------------TVMRALKKALD 427
            :....:    .:|||                          |:|:..:||::
plant   367 KLRAAV----RVGENRDSVPDSDKLARILAESAREDLPERVTLMKLREKAME 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 85/377 (23%)
AT1G06000NP_563756.1 Glycosyltransferase_GTB-type 8..430 CDD:385653 85/377 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.