DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and AT5G03490

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_195969.1 Gene:AT5G03490 / 831823 AraportID:AT5G03490 Length:465 Species:Arabidopsis thaliana


Alignment Length:466 Identity:94/466 - (20%)
Similarity:158/466 - (33%) Gaps:132/466 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SQPDELVEAAGPLKVLGLFPHPGVSHFHFFHPIMKGLAEAGHDVSVV--------------SH-- 64
            |:|..:|          :||.|...|......:...|...|.:|||:              :|  
plant    15 SKPPHIV----------VFPFPAQGHLLPLLDLTHQLCLRGFNVSVIVTPGNLTYLSPLLSAHPS 69

  Fly    65 ------FP-DKHP-----VAHYKDFPLTGMDKLTNSVDLKFFEK---RTFYSH-------FQEFF 107
                  || ..||     |.:.||...:|  .|.....|:...:   ..|.||       ..:||
plant    70 SVTSVVFPFPPHPSLSPGVENVKDVGNSG--NLPIMASLRQLREPIINWFQSHPNPPIALISDFF 132

  Fly   108 LLYDWGKQTCN-LTLRSEALQQILRRPGRFDVIIMEQF---NTDCMMGV--AHQLQAPVIALSSC 166
            |  .|....|| :.:...|...|     .|.::.:.||   |.|.:...  .|.|..|       
plant   133 L--GWTHDLCNQIGIPRFAFFSI-----SFFLVSVLQFCFENIDLIKSTDPIHLLDLP------- 183

  Fly   167 VMMPWHYERMGAPLI-PSHIPALFMAQSQHMNFGGRLANWFSTHALNWMYKLLSVPAADAMVQYK 230
                      .||:. ..|:|::                         :.:.|..|:.|......
plant   184 ----------RAPIFKEEHLPSI-------------------------VRRSLQTPSPDLESIKD 213

  Fly   231 FGHDVPSVG------ELVKNTSMFFVNQHYSLSGPKVTPPNVIELGGIHIQKSKPLPADLQRILD 289
            |..::.|.|      |::::..:.:|.|........|..| :..:|......|..:...|...||
plant   214 FSMNLLSYGSVFNSSEILEDDYLQYVKQRMGHDRVYVIGP-LCSIGSGLKSNSGSVDPSLLSWLD 277

  Fly   290 NAEEG-VILISWGSMIRANSLSAAKRDGIIRAVARLKQKVIWKWENETLPN------QPPNMHIM 347
            .:..| |:.:.:||.   .:|:..:.|.:...:.:...:.:|..:.:.:|:      ....:.:.
plant   278 GSPNGSVLYVCFGSQ---KALTKDQCDALALGLEKSMTRFVWVVKKDPIPDGFEDRVSGRGLVVR 339

  Fly   348 KWLPQRDILCHPNVKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVNTAALVE---------RG 403
            .|:.|..:|.|..|..|:||.|.....|....|..::..||..|||||...|||         .|
plant   340 GWVSQLAVLRHVAVGGFLSHCGWNSVLEGITSGAVILGWPMEADQFVNARLLVEHLGVAVRVCEG 404

  Fly   404 MGTILNFEDIG 414
            ..|:.:.:::|
plant   405 GETVPDSDELG 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 92/461 (20%)
AT5G03490NP_195969.1 Glycosyltransferase_GTB_type 19..460 CDD:299143 92/462 (20%)
YjiC 19..447 CDD:224732 92/462 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.