DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and UGT78D2

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_197207.1 Gene:UGT78D2 / 831568 AraportID:AT5G17050 Length:460 Species:Arabidopsis thaliana


Alignment Length:230 Identity:53/230 - (23%)
Similarity:93/230 - (40%) Gaps:51/230 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 FGHDVPSVGELVKNTSMFFVNQHYSLSGPKVTP------PNVIELGGIHIQKSKPLPADLQRILD 289
            |...:..:|..:...:..|:|....|. |.:|.      ...:.:|.:.:     |.:.||:::.
plant   204 FSKMLHQMGLALPRATAVFINSFEDLD-PTLTNNLRSRFKRYLNIGPLGL-----LSSTLQQLVQ 262

  Fly   290 N-----------AEEGVILISWGSMIR--ANSLSAAKRDGIIRAVARLKQKVIWKWENETLPNQP 341
            :           :...|..||:|:::.  ...|:|     |...:...|...:|..:.::|...|
plant   263 DPHGCLAWMEKRSSGSVAYISFGTVMTPPPGELAA-----IAEGLESSKVPFVWSLKEKSLVQLP 322

  Fly   342 PNM--------HIMKWLPQRDILCHPNVKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVNTAA 398
            ...        .::.|.||.::|.|....||::|.|.....|:...|||::..|.:|||.:|..|
plant   323 KGFLDRTREQGIVVPWAPQVELLKHEATGVFVTHCGWNSVLESVSGGVPMICRPFFGDQRLNGRA 387

  Fly   399 LV---ERGMGTILN--FEDIGENTVMRALKKALDK 428
            :.   |.|| ||:|  |...|       .:|.|||
plant   388 VEVVWEIGM-TIINGVFTKDG-------FEKCLDK 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 53/230 (23%)
UGT78D2NP_197207.1 GT1_Gtf-like 12..438 CDD:340817 53/230 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.