DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and AT5G05900

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_196209.1 Gene:AT5G05900 / 830475 AraportID:AT5G05900 Length:450 Species:Arabidopsis thaliana


Alignment Length:275 Identity:55/275 - (20%)
Similarity:92/275 - (33%) Gaps:110/275 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 WMYKLLSVPAADAMVQYKFGHDVPSVGELVKNT-SMFFVNQHYSLSGPKV-----TPPNVIELGG 271
            |::   :.|.|.:.          ::..||.|| .:.|...|:.|  |::     .|....|.|.
plant   120 WIF---TQPVAQSF----------NLPRLVLNTYKVSFFRDHFVL--PQLRREMYLPLQDSEQGD 169

  Fly   272 IHIQKSKPL-PADLQRILD-----------------NAEEGVILISWGSMIRANSLSAAKRD--- 315
            ..:::..|| ..||.:|||                 .|..|:|.:|....:..:|||.|:.|   
plant   170 DPVEEFPPLRKKDLLQILDQESEQLDSYSNMILETTKASSGLIFVSTCEELDQDSLSQAREDYQV 234

  Fly   316 -------------------------------------------GIIRAVARLK-QKVIWKWENET 336
                                                       |.|..:...: .::.|...|. 
plant   235 PIFTIGPSHSYFPGSSSSLFTVDETCIPWLDKQEDKSVIYVSFGSISTIGEAEFMEIAWALRNS- 298

  Fly   337 LPNQP-----------------PNMH----IMKWLPQRDILCHPNVKVFMSHGGLMGTSEAAYCG 380
              :||                 ..:|    |:.|.||:::|.|..:..|::|.|...|.|:.:.|
plant   299 --DQPFLWVVRGGSVVHGAEWIEQLHEKGKIVNWAPQQEVLKHQAIGGFLTHNGWNSTVESVFEG 361

  Fly   381 VPVVATPMYGDQFVN 395
            ||::..|...||.:|
plant   362 VPMICMPFVWDQLLN 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 55/275 (20%)
AT5G05900NP_196209.1 Glycosyltransferase_GTB_type 2..447 CDD:299143 55/275 (20%)
YjiC 8..436 CDD:224732 55/275 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.