DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and AT4G27570

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_194487.1 Gene:AT4G27570 / 828866 AraportID:AT4G27570 Length:453 Species:Arabidopsis thaliana


Alignment Length:456 Identity:93/456 - (20%)
Similarity:146/456 - (32%) Gaps:169/456 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFLALALSQPDELVEAAGPLKVL------GLFPHPGVSHFHFFH----PIMKGL---AEAGHDVS 60
            ||||..|::....|....|.|.|      .||||..|     |.    |.:.||   .|...::.
plant    23 LFLANKLAEKGHTVTFLLPKKSLKQLEHFNLFPHNIV-----FRSVTVPHVDGLPVGTETASEIP 82

  Fly    61 VVSHFPDKHPVAHYKDFPLTGMDKLTNSV---------DLKFFEKRTFYSHF-QEFFLLYDWGKQ 115
            |.|           .|..::.||...:.|         ||.||:    ::|: .|  :..|:|.:
plant    83 VTS-----------TDLLMSAMDLTRDQVEAVVRAVEPDLIFFD----FAHWIPE--VARDFGLK 130

  Fly   116 TCNLTLRSEAL---------------------QQILRRPGRFDVIIMEQFNTDCMMGVAHQLQAP 159
            |....:.|.:.                     :.:||:...:.:..:|..||   :.|...|   
plant   131 TVKYVVVSASTIASMLVPGGELGVPPPGYPSSKVLLRKQDAYTMKKLEPTNT---IDVGPNL--- 189

  Fly   160 VIALSSCVMMPWHYERMGAPLIPSHIPALFMAQSQHMNFGGRLANWFSTHALNWMYKLLSVPA-- 222
                         .||:...|:.|.:.|:..|:....||    .::...|....:  ||:.|.  
plant   190 -------------LERVTTSLMNSDVIAIRTAREIEGNF----CDYIEKHCRKKV--LLTGPVFP 235

  Fly   223 --------ADAMVQYKFGHDVPSVGELVKNTSMFFVNQHY-------SLSGP----KVTPPNVIE 268
                    .:..|::..|::..||......:.:......:       .|:|.    .|.||.   
plant   236 EPDKTRELEERWVKWLSGYEPDSVVFCALGSQVILEKDQFQELCLGMELTGSPFLVAVKPPR--- 297

  Fly   269 LGGIHIQKSKPLPADLQRILDNAEEGVILISWGSMIRANSLSAAKRDGIIRAVARLKQKVIWKWE 333
             |...||::.|         :..||.|                 |..|::             |.
plant   298 -GSSTIQEALP---------EGFEERV-----------------KGRGLV-------------WG 322

  Fly   334 NETLPNQPPNMHIMKWLPQRDILCHPNVKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVNTAA 398
            .              |:.|..||.||:|..|:||.|.....|:......:|..|..|||.:||..
plant   323 G--------------WVQQPLILSHPSVGCFVSHCGFGSMWESLLSDCQIVLVPQLGDQVLNTRL 373

  Fly   399 L 399
            |
plant   374 L 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 88/444 (20%)
AT4G27570NP_194487.1 PLN02764 1..452 CDD:178364 93/456 (20%)
MGT 15..414 CDD:273616 93/456 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.