DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and UGT84A3

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_193284.1 Gene:UGT84A3 / 827221 AraportID:AT4G15490 Length:479 Species:Arabidopsis thaliana


Alignment Length:463 Identity:99/463 - (21%)
Similarity:162/463 - (34%) Gaps:149/463 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GPLKVLGLFPHPGVSHFHFFHPIMKGLAEAGHDVSVVSHFPDKHPVAHYKDFPLTGMDKLTNSVD 90
            |.||.:||    |...|.||   ..|.|:.                                  |
plant    59 GVLKPVGL----GFIRFEFF---SDGFADD----------------------------------D 82

  Fly    91 LKFFEKRTFYSHFQEFFLLYDWGKQTCNLTLRSEALQQILRRPGRFDV--IIMEQFNTDCMMGVA 153
            .|.|:...|..|.:..      |||         .::.:::|..:..|  :|...| ...:..||
plant    83 EKRFDFDAFRPHLEAV------GKQ---------EIKNLVKRYNKEPVTCLINNAF-VPWVCDVA 131

  Fly   154 HQLQAP--VIALSSCVMMPWHYE----------------RMGAPLIP----SHIPALFMAQSQHM 196
            .:|..|  |:.:.||..:..:|.                .:..|.:|    ..||:.....|.:.
plant   132 EELHIPSAVLWVQSCACLTAYYYYHHRLVKFPTKTEPDISVEIPCLPLLKHDEIPSFLHPSSPYT 196

  Fly   197 NFGGRLANW---FSTHALNWMYKLLSVPAADAMVQYKFGHDVPSVGELVKNTSMFFVNQHYSLSG 258
            .||..:.:.   |..|...:::                   :.:..||.|:     :..|.|   
plant   197 AFGDIILDQLKRFENHKSFYLF-------------------IDTFRELEKD-----IMDHMS--- 234

  Fly   259 PKVTPPNVIELGGIHIQKSKPLPADLQ-----------RILDNAE-EGVILISWGSMIRANSLSA 311
             ::.|..:|...|...:.::.|.:|::           ..||:.| ..|:.||:|::  || |..
plant   235 -QLCPQAIISPVGPLFKMAQTLSSDVKGDISEPASDCMEWLDSREPSSVVYISFGTI--AN-LKQ 295

  Fly   312 AKRDGIIRAVARLKQKVIWK---------WENETLPNQ-PPNMHIMKWLPQRDILCHPNVKVFMS 366
            .:.:.|...|......|:|.         .|...||.: .....|::|.||..:|.||.:..|:|
plant   296 EQMEEIAHGVLSSGLSVLWVVRPPMEGTFVEPHVLPRELEEKGKIVEWCPQERVLAHPAIACFLS 360

  Fly   367 HGGLMGTSEAAYCGVPVVATPMYGDQFVNTAAL-------VERGMGT----ILNFEDIGENTVMR 420
            |.|...|.||...|||||..|.:|||..:...|       |..|.|.    |::.|.:.|..:..
plant   361 HCGWNSTMEALTAGVPVVCFPQWGDQVTDAVYLADVFKTGVRLGRGAAEEMIVSREVVAEKLLEA 425

  Fly   421 AL-KKALD 427
            .: :||::
plant   426 TVGEKAVE 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 99/463 (21%)
UGT84A3NP_193284.1 PLN02555 1..479 CDD:178170 99/463 (21%)
YjiC 8..450 CDD:224732 99/463 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.