DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and AT4G15260

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_193261.2 Gene:AT4G15260 / 827192 AraportID:AT4G15260 Length:359 Species:Arabidopsis thaliana


Alignment Length:256 Identity:56/256 - (21%)
Similarity:94/256 - (36%) Gaps:73/256 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 VPSVGELVKNTSMFFVN----QHYSLSGPKVTPPNVIELGGIHIQKSKPLPADLQRILDNAEEGV 295
            |.:|.||..:....|.|    |.|.: ||      |:.|........|.|.. |:.:.|...:.|
plant    97 VNTVAELEPHALKMFNNVDLPQAYPV-GP------VLHLDNGDDDDEKRLEV-LRWLDDQPPKSV 153

  Fly   296 ILISWGSMIRANSLSAAKRDGIIRAVARLKQKVIWKWENETLPNQPPNM---------------- 344
            :.:.:|||   ...:..:...:..|:.|...:.:|     :|....||:                
plant   154 LFLCFGSM---GGFTEEQTREVAVALNRSGHRFLW-----SLRRASPNIMMERPGDYKNLEEVLP 210

  Fly   345 -----------HIMKWLPQRDILCHPNVKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVNTAA 398
                       .::.|.||..:|..|.:..|::|.|.....|:.:.|||:|..|:|.:|.||...
plant   211 DGFLERTLDRGKVIGWAPQVAVLEKPAIGGFVTHCGWNSMLESLWFGVPMVTWPLYAEQKVNAFE 275

  Fly   399 LVER------------------GMGTILNFEDI--------GENTVMRALKKALDKKFHDA 433
            :||.                  |...|:..|||        .:::.:|:..|.:.:|.|.|
plant   276 MVEELGLAVEIRKCISGDLLLIGEMEIVTAEDIERAIRCVMEQDSDVRSRVKEMAEKCHVA 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 56/256 (22%)
AT4G15260NP_193261.2 Glycosyltransferase_GTB_type <1..359 CDD:299143 56/256 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.