DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and AT3G46650

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_190249.4 Gene:AT3G46650 / 823818 AraportID:AT3G46650 Length:435 Species:Arabidopsis thaliana


Alignment Length:517 Identity:110/517 - (21%)
Similarity:177/517 - (34%) Gaps:182/517 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LFPHPGVSHFHFFHPIMKGLAEAGHDVSVV-----------SHFPDKHPVAHYKDFPLTGMDKLT 86
            |.|.|...|......:.|.|...|..::||           .|||....|...:..|.:..:|| 
plant    13 LVPIPAQGHVTPLMQLGKVLNSKGFSITVVEGHFNQVSSSSQHFPGFQFVTIKESLPESEFEKL- 76

  Fly    87 NSVDLKFFEKRTFYSHFQEFFLLYDWGKQTCNLTLRSEALQQILRRPGRFDV--IIMEQFNTDCM 149
            ..::......:|..:.|:                   :.:.|:|.:.|. |:  ||.:::...| 
plant    77 GGIESMITLNKTSEASFK-------------------DCISQLLLQQGN-DIACIIYDEYMYFC- 120

  Fly   150 MGVAHQLQAPVIALSSCVMMPWHYERMGAPLIPSHIPA-LFMAQSQHMNFGGRLANWFS-----T 208
                                       ||......||: :|..||        .||:.|     .
plant   121 ---------------------------GAAAKEFSIPSVIFSTQS--------AANYVSHPDMQD 150

  Fly   209 HALNWMYKLLSVPAADAMVQYKFGHDVPSVG--------EL--------------------VKNT 245
            ..:..:|.|          :||   |:|:.|        ||                    ::::
plant   151 KVVENLYPL----------RYK---DLPTSGMGPLDRFFELCREVANKRTASAVIINTVSCLESS 202

  Fly   246 SMFFVNQHYSLSGPKVTPPNVIELGGIHIQKSKP---LPAD---LQRILDNAEEGVILISWGSMI 304
            |:.::.|...:|        |..||.:|:..|.|   |..|   ::.:.....:.||.||.|::.
plant   203 SLSWLEQKVGIS--------VYPLGPLHMTDSSPSSLLEEDRSCIEWLNKQKPKSVIYISIGTLG 259

  Fly   305 RANSLSAAKRD-----------GIIRAVARLKQKVIWKWENETLPNQPPNM-----HIMKWLPQR 353
            :..:....:..           .:|||.:.|....|     |:||.....|     :|:|..||.
plant   260 QMETKEVLEMSWGLCNSNQPFLWVIRAGSILGTNGI-----ESLPEDVNKMVSERGYIVKRAPQI 319

  Fly   354 DILCHPNVKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVNTAAL------------------V 400
            ::|.||.|..|.||.|.....|:...|||::..|.:|:|.:|...|                  |
plant   320 EVLGHPAVGGFWSHCGWNSILESIGEGVPMICKPFHGEQKLNAMYLECVWKIGIQVEGDLERGAV 384

  Fly   401 ERGMGTILNFEDIGENTVMRALKKALDKKFHDAAKVVSHSFHHRPQQALHTAIWWVEHVAHT 462
            ||.:..:..||: ||.  ||  |:|:..|....|.|       |...:||.::...||...|
plant   385 ERAVKRLTVFEE-GEE--MR--KRAVTLKEELRASV-------RGGGSLHNSLKEFEHFMMT 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 110/517 (21%)
AT3G46650NP_190249.4 Glycosyltransferase_GTB-type 1..435 CDD:385653 110/517 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.