DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and AT3G21790

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_188816.1 Gene:AT3G21790 / 821733 AraportID:AT3G21790 Length:495 Species:Arabidopsis thaliana


Alignment Length:169 Identity:41/169 - (24%)
Similarity:70/169 - (41%) Gaps:33/169 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 TPPNVIELGG-IHIQKSKPLPADLQRI-----LD-NAEEGVILISWGSMIRANSLSAAKRDGIIR 319
            ||| |..:|. :|::..:....|.:|:     || .....|:.:.:|||   ......:...|..
plant   238 TPP-VYPVGPLLHLENQRDDSKDEKRLEIIRWLDQQPPSSVVFLCFGSM---GGFGEEQVREIAI 298

  Fly   320 AVARLKQKVIWKWEN------ETLPNQPPNMH----------------IMKWLPQRDILCHPNVK 362
            |:.|...:.:|....      :.||.:..|:.                ::.|.||..:|.:|.:.
plant   299 ALERSGHRFLWSLRRASPNIFKELPGEFTNLEEVLPEGFFDRTKDIGKVIGWAPQVAVLANPAIG 363

  Fly   363 VFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVNTAALVE 401
            .|::|.|...|.|:.:.|||..|.|:|.:|..|...:||
plant   364 GFVTHCGWNSTLESLWFGVPTAAWPLYAEQKFNAFLMVE 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 41/169 (24%)
AT3G21790NP_188816.1 PLN02554 1..483 CDD:215304 41/169 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.