DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and UGT71B6

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_188815.2 Gene:UGT71B6 / 821732 AraportID:AT3G21780 Length:479 Species:Arabidopsis thaliana


Alignment Length:294 Identity:61/294 - (20%)
Similarity:105/294 - (35%) Gaps:87/294 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 VPSVGELVKNTSMFFVNQHYSLSGPKVTPPN-VIELGGIHIQKSKPLPADLQRILD-NAEEGVIL 297
            |.:|.:|......|..|.:.    |:..|.. ::.|..::........:::.|.|| .....|:.
plant   210 VNTVPDLEPQALTFLSNGNI----PRAYPVGPLLHLKNVNCDYVDKKQSEILRWLDEQPPRSVVF 270

  Fly   298 ISWGSM-------IRANSLSAAKRDGIIRAVARLKQKVIWKWENETLPN---QPP----NMH--- 345
            :.:|||       :|..:|          |:.|...:.:|.....: ||   :||    |:.   
plant   271 LCFGSMGGFSEEQVRETAL----------ALDRSGHRFLWSLRRAS-PNILREPPGEFTNLEEIL 324

  Fly   346 -------------IMKWLPQRDILCHPNVKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVNTA 397
                         ::.|..|..||..|.:..|:||||...|.|:.:.|||:...|:|.:|..|..
plant   325 PEGFFDRTANRGKVIGWAEQVAILAKPAIGGFVSHGGWNSTLESLWFGVPMAIWPLYAEQKFNAF 389

  Fly   398 ALVER-----------------GMGTILNFEDIGENTVMRALKKALDKKFHDAAKVVSHSFHHRP 445
            .:||.                 |...|:..|:|.:..:      .|.::..|..|.|:..     
plant   390 EMVEELGLAVEIKKHWRGDLLLGRSEIVTAEEIEKGII------CLMEQDSDVRKRVNEI----- 443

  Fly   446 QQALHTAIWWVEHVAHTGGAPLLKPSAVEMSRFV 479
            .:..|.|:.       .||:     |...:.||:
plant   444 SEKCHVALM-------DGGS-----SETALKRFI 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 61/294 (21%)
UGT71B6NP_188815.2 PLN02554 1..473 CDD:215304 61/294 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.