DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and UGT88A1

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_566550.1 Gene:UGT88A1 / 820900 AraportID:AT3G16520 Length:462 Species:Arabidopsis thaliana


Alignment Length:341 Identity:68/341 - (19%)
Similarity:112/341 - (32%) Gaps:107/341 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 HQLQAPVIALSSCVMMPWHYERMGAPLI----PSHIPALFMAQSQHMNFGGRLANWFSTHALN-- 212
            |.|.| |...||......|:|.:...::    ||....|| :.|::.|....:.::|.|..|:  
plant    67 HHLPA-VTPYSSSSTSRHHHESLLLEILCFSNPSVHRTLF-SLSRNFNVRAMIIDFFCTAVLDIT 129

  Fly   213 --------WMYK--------LLSVPAADAMVQYKFGHDVPSV----------------------- 238
                    :.|.        ...:|..|.....|...|:|:|                       
plant   130 ADFTFPVYFFYTSGAACLAFSFYLPTIDETTPGKNLKDIPTVHIPGVPPMKGSDMPKAVLERDDE 194

  Fly   239 --------GELVKNTSMFFVNQHYSLS-------------------GPKVTPPNVIELGGIHIQK 276
                    |:.:..:|...:|...:|.                   ||      :|..|.|..:.
plant   195 VYDVFIMFGKQLSKSSGIIINTFDALENRAIKAITEELCFRNIYPIGP------LIVNGRIEDRN 253

  Fly   277 SKPLPADLQRILDNAEEGVILISWGSMIRANSLSAAKRDGIIRAVARLK---QKVIWKWEN---- 334
            .....:.|..:....|:.|:.:.:|      ||....::.:|.....|:   |:.:|...|    
plant   254 DNKAVSCLNWLDSQPEKSVVFLCFG------SLGLFSKEQVIEIAVGLEKSGQRFLWVVRNPPEL 312

  Fly   335 --------ETLP------NQPPNMHIMKWLPQRDILCHPNVKVFMSHGGLMGTSEAAYCGVPVVA 385
                    ..||      .:...|.:..|.||..:|.|..|..|::|.|.....||...|||:||
plant   313 EKTELDLKSLLPEGFLSRTEDKGMVVKSWAPQVPVLNHKAVGGFVTHCGWNSILEAVCAGVPMVA 377

  Fly   386 TPMYGDQFVNTAALVE 401
            .|:|.:|..|...:|:
plant   378 WPLYAEQRFNRVMIVD 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 68/341 (20%)
UGT88A1NP_566550.1 PLN03004 1..451 CDD:178581 68/341 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.