DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and UGT76B1

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_187742.1 Gene:UGT76B1 / 820307 AraportID:AT3G11340 Length:447 Species:Arabidopsis thaliana


Alignment Length:429 Identity:93/429 - (21%)
Similarity:143/429 - (33%) Gaps:127/429 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VLGLFPHPGVSHFHFFHPIMKGLAEAGHDVSVVSHFPDKHPVAHYKDFPLTGMDKLTNSVDLKFF 94
            |:.|||.|...|.:....:.......|..::|:           :.:|         ||.:...|
plant     9 VIFLFPFPLQGHLNPMFQLANIFFNRGFSITVI-----------HTEF---------NSPNSSNF 53

  Fly    95 EKRTFYSHFQEFFLLYDWGKQTCNLTLRSEALQQILRRPGRF-DVI-IMEQFNTDCMMGVAHQL- 156
            ...||.|                        :...|..|..: ||| |:...|:.|:......| 
plant    54 PHFTFVS------------------------IPDSLSEPESYPDVIEILHDLNSKCVAPFGDCLK 94

  Fly   157 ----QAPVIALSSCVMMP--WHY-----ERMGAPLIPSHIPAL--FMAQSQHMNFGGRLANWFST 208
                :.|..|   ||::.  |::     |:...|.|......|  |:|.|:.             
plant    95 KLISEEPTAA---CVIVDALWYFTHDLTEKFNFPRIVLRTVNLSAFVAFSKF------------- 143

  Fly   209 HALNWM-YKLLSVPAADAMV---QYKFGHDVP---------------SVGELVKNTSMFFVNQHY 254
            |.|... |..|....||:.|   .|....|:|               .|.:.:|::|....|...
plant   144 HVLREKGYLSLQETKADSPVPELPYLRMKDLPWFQTEDPRSGDKLQIGVMKSLKSSSGIIFNAIE 208

  Fly   255 SLSGPKVT------PPNVIELGGIH----IQKSKPLPADLQRI--LD-NAEEGVILISWGSMIRA 306
            .|...::.      |..:..:|..|    ...|..|..|:..:  || .|...||..|.||:.  
plant   209 DLETDQLDEARIEFPVPLFCIGPFHRYVSASSSSLLAHDMTCLSWLDKQATNSVIYASLGSIA-- 271

  Fly   307 NSLSAAKRDGIIRAVARLKQKVIW----------KWENETLP-----NQPPNMHIMKWLPQRDIL 356
             |:..::...|...:....|..:|          :| .|.||     |......|:||.||.::|
plant   272 -SIDESEFLEIAWGLRNSNQPFLWVVRPGLIHGKEW-IEILPKGFIENLEGRGKIVKWAPQPEVL 334

  Fly   357 CHPNVKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVN 395
            .|.....|::|.|...|.|.....:|::..|.:|||.||
plant   335 AHRATGGFLTHCGWNSTLEGICEAIPMICRPSFGDQRVN 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 93/429 (22%)
UGT76B1NP_187742.1 Glycosyltransferase_GTB-type 1..444 CDD:415824 93/429 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.