DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and UGT74F2

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_181910.1 Gene:UGT74F2 / 818986 AraportID:AT2G43820 Length:449 Species:Arabidopsis thaliana


Alignment Length:384 Identity:80/384 - (20%)
Similarity:138/384 - (35%) Gaps:128/384 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 MEQFNTDCMMGVAHQLQA------PVIALSSCVMMPWHYERMGAPLIPSHIPALFMAQSQHMNFG 199
            ::.|.|.....:|..:|.      |:..:.....:||               ||.:|:.     .
plant    80 LKDFKTSGSKTIADIIQKHQTSDNPITCIVYDAFLPW---------------ALDVARE-----F 124

  Fly   200 GRLANWFSTH--ALNWMYKL-------LSVP--------AADAMVQYKFGHDVPSVGELV----- 242
            |.:|..|.|.  |:|::|.|       |.:|        ..|....:......|:..|:|     
plant   125 GLVATPFFTQPCAVNYVYYLSYINNGSLQLPIEELPFLELQDLPSFFSVSGSYPAYFEMVLQQFI 189

  Fly   243 --KNTSMFFVNQ------HYSLSGPKVTPPNVIELG----GIHIQKSKPLPADLQRI-------- 287
              :......||.      |.:....|..|  |:.:|    .|::.         |||        
plant   190 NFEKADFVLVNSFQELELHENELWSKACP--VLTIGPTIPSIYLD---------QRIKSDTGYDL 243

  Fly   288 --------------LDNAEEG-VILISWGSMIRANSLSAAKRDGIIRAVARLKQKVIW---KWEN 334
                          ||...:| |:.:::|||.:   |:..:.:.:..||:..  ..:|   ..|.
plant   244 NLFESKDDSFCINWLDTRPQGSVVYVAFGSMAQ---LTNVQMEELASAVSNF--SFLWVVRSSEE 303

  Fly   335 ETLP-------NQPPNMHIMKWLPQRDILCHPNVKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQ 392
            |.||       |:..:: ::||.||..:|.:..:..|::|.|...|.||...|||:||.|.:.||
plant   304 EKLPSGFLETVNKEKSL-VLKWSPQLQVLSNKAIGCFLTHCGWNSTMEALTFGVPMVAMPQWTDQ 367

  Fly   393 FVNTAAL-----------VERGMGTI------LNFEDIGENTVMRALKKALDKKFHDAA 434
            .:|...:           .|:..|..      .:.:::.|....:.:||.: ||:.|.|
plant   368 PMNAKYIQDVWKAGVRVKTEKESGIAKREEIEFSIKEVMEGERSKEMKKNV-KKWRDLA 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 80/384 (21%)
UGT74F2NP_181910.1 PLN02173 1..449 CDD:177830 80/384 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.