DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and AT2G36970

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_181234.1 Gene:AT2G36970 / 818271 AraportID:AT2G36970 Length:490 Species:Arabidopsis thaliana


Alignment Length:451 Identity:82/451 - (18%)
Similarity:143/451 - (31%) Gaps:142/451 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LFPHPGVSH-FHFFHPIMKGLAEAGHDVSVVSHFPDKHPV--AHYKD------------------ 76
            :.|:|...| ..|.|..:| ||..|..::.|:.....|.:  ||..|                  
plant    13 MIPYPLQGHVIPFVHLAIK-LASHGFTITFVNTDSIHHHISTAHQDDAGDIFSAARSSGQHDIRY 76

  Fly    77 ------FPLTGMDKLTNSVDLKFFE--KRTFYSHFQEFF-----------------LLYDWGKQT 116
                  ||| ..|:..|..  :|||  ...|.:|..:..                 ..|.|....
plant    77 TTVSDGFPL-DFDRSLNHD--QFFEGILHVFSAHVDDLIAKLSRRDDPPVTCLIADTFYVWSSMI 138

  Fly   117 CN--------------LTLRSEALQQILRRPGRFDVIIMEQFNTDCMMGVAHQLQAPVIALSSCV 167
            |:              |.|.......:|...|.|..:...:...|.:.||               
plant   139 CDKHNLVNVSFWTEPALVLNLYYHMDLLISNGHFKSLDNRKDVIDYVPGV--------------- 188

  Fly   168 MMPWHYERMGAPLIPSHIPALFMAQSQHMNFGGRLANWFSTHALNWMYKLLSVPAADAMVQYKFG 232
                      ..:.|..:.:......:.::          |:.:  :|::|          :|..
plant   189 ----------KAIEPKDLMSYLQVSDKDVD----------TNTV--VYRIL----------FKAF 221

  Fly   233 HDVPSVGELVKNTSMFFVNQHYSLSGPKVTPPNVIELGGIHIQKSKPLPADLQRILDNAE----- 292
            .||.....:|.||....  :..|||..:...| |..:|.: ......:|..|....|..|     
plant   222 KDVKRADFVVCNTVQEL--EPDSLSALQAKQP-VYAIGPV-FSTDSVVPTSLWAESDCTEWLKGR 282

  Fly   293 --EGVILISWGSMIRANSLSAAKRDGIIRAVARLKQKV--IWKWENETLPNQPPNM--------- 344
              ..|:.:|:||...     ..|::.:..|...|...:  ||....:.:.:..|:.         
plant   283 PTGSVLYVSFGSYAH-----VGKKEIVEIAHGLLLSGISFIWVLRPDIVGSNVPDFLPAGFVDQA 342

  Fly   345 ----HIMKWLPQRDILCHPNVKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVNTAALVE 401
                .:::|..|.:::.:|.|..|.:|.|.....|:.:||:|::..|:..|||.|...:|:
plant   343 QDRGLVVQWCCQMEVISNPAVGGFFTHCGWNSILESVWCGLPLLCYPLLTDQFTNRKLVVD 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 82/451 (18%)
AT2G36970NP_181234.1 Glycosyltransferase_GTB_type 1..470 CDD:299143 82/451 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.