DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and UGT71C1

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_180536.1 Gene:UGT71C1 / 817525 AraportID:AT2G29750 Length:481 Species:Arabidopsis thaliana


Alignment Length:215 Identity:53/215 - (24%)
Similarity:88/215 - (40%) Gaps:52/215 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 PNVIELGGIHIQKSKPL--PADLQRIL----DNAEEGVILISWGSMIRANSLSAAKRDGIIRAVA 322
            |.:..:|.|.....:|.  .::..||:    |..|..|:.:.:||:   .:|||.:.:.|.:|:.
plant   249 PTIYPIGPILCSNDRPNLDSSERDRIITWLDDQPESSVVFLCFGSL---KNLSATQINEIAQALE 310

  Fly   323 RLKQKVIWKWEN---------ETLPNQPPNMH-----------IMKWLPQRDILCHPNVKVFMSH 367
            .:..|.||.:..         |.||      |           :..|.||.:||.|..|..|:||
plant   311 IVDCKFIWSFRTNPKEYASPYEALP------HGFMDRVMDQGIVCGWAPQVEILAHKAVGGFVSH 369

  Fly   368 GGLMGTSEAAYCGVPVVATPMYGDQFVNTAALV-ERGMGTILNFEDIGEN----------TVMRA 421
            .|.....|:...|||:...|||.:|.:|...:| |.|:...:..:.:.|:          ..:|:
plant   370 CGWNSILESLGFGVPIATWPMYAEQQLNAFTMVKELGLALEMRLDYVSEDGDIVKADEIAGTVRS 434

  Fly   422 LKKALD------KKFHDAAK 435
            |...:|      |:..:|.|
plant   435 LMDGVDVPKSKVKEIAEAGK 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 53/215 (25%)
UGT71C1NP_180536.1 PLN02167 4..478 CDD:215112 53/215 (25%)
MGT 14..465 CDD:273616 53/215 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.