DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and AT2G16890

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_179281.3 Gene:AT2G16890 / 816190 AraportID:AT2G16890 Length:478 Species:Arabidopsis thaliana


Alignment Length:215 Identity:50/215 - (23%)
Similarity:85/215 - (39%) Gaps:65/215 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 VKNTSM---FFVNQHYSL----------SGPK-----------VTPPNVIELGGIHIQKSKPLPA 282
            :|:|:.   |.||..|.|          ||.|           ..||          ::....||
plant   213 IKSTTTSHGFLVNSFYELESAFVDYNNNSGDKPKSWCVGPLCLTDPP----------KQGSAKPA 267

  Fly   283 DLQRILDNAEEG--VILISWGSMI-----------------RANSLSAAKRDGIIRAVARLKQKV 328
            .:..:....|||  |:.:::|:..                 :.|.|...::|         .:::
plant   268 WIHWLDQKREEGRPVLYVAFGTQAEISNKQLMELAFGLEDSKVNFLWVTRKD---------VEEI 323

  Fly   329 IWKWENETLPNQPPNMHIMKWLPQRDILCHPNVKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQF 393
            |.:..|:.:  :...|.:..|:.|.:||.|.:||.|:||.|.....|:...|||::|.||..:|.
plant   324 IGEGFNDRI--RESGMIVRDWVDQWEILSHESVKGFLSHCGWNSAQESICVGVPLLAWPMMAEQP 386

  Fly   394 VNTAALVER-GMGTILNFED 412
            :|...:||. .:|..:..||
plant   387 LNAKMVVEEIKVGVRVETED 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 50/215 (23%)
AT2G16890NP_179281.3 Glycosyltransferase_GTB_type 9..467 CDD:299143 50/215 (23%)
YjiC 9..440 CDD:224732 50/215 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.