DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and UGT73B4

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_179151.2 Gene:UGT73B4 / 816041 AraportID:AT2G15490 Length:484 Species:Arabidopsis thaliana


Alignment Length:430 Identity:94/430 - (21%)
Similarity:145/430 - (33%) Gaps:135/430 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VAHYKDFPLTGMDK-----------LTNSVDLKFFEKRTFYSHFQEFFLLYDWGKQTCNLTLRSE 124
            :||....||..|.|           ||..::.|..||..      |.|.:     |..:|.:..:
plant    14 MAHGHMIPLLDMAKLFARRGAKSTLLTTPINAKILEKPI------EAFKV-----QNPDLEIGIK 67

  Fly   125 ALQ------------------QILRRPGRFDVIIMEQFNTDCMMGVAHQLQAPV-----IALSSC 166
            .|.                  ...::...||:.:...|:|..|   ..||::.:     .||.:.
plant    68 ILNFPCVELGLPEGCENRDFINSYQKSDSFDLFLKFLFSTKYM---KQQLESFIETTKPSALVAD 129

  Fly   167 VMMPW---HYERMGAPLIPSHIPALF-MAQSQHMNFGGRLANWFSTHALNWMYKLLSVP------ 221
            :..||   ..|::|.|.:..|..:.| :..|.:|..          |..:......|.|      
plant   130 MFFPWATESAEKIGVPRLVFHGTSSFALCCSYNMRI----------HKPHKKVASSSTPFVIPGL 184

  Fly   222 AADAMV----------QYKFGHDVPSVGELVKNTSMF--FVNQHYSLS----------------- 257
            ..|.::          :..||.....|.|  ..||.|  .||..|.|.                 
plant   185 PGDIVITEDQANVTNEETPFGKFWKEVRE--SETSSFGVLVNSFYELESSYADFYRSFVAKKAWH 247

  Fly   258 -GP-KVTPPNVIELGGIHIQKSKPLPADLQ---RILDNAEEG-VILISWGSMIRANSLSAAKRDG 316
             || .::...:.|..|    :.|....|.|   :.||:...| |:.:|:||.      :....:.
plant   248 IGPLSLSNRGIAEKAG----RGKKANIDEQECLKWLDSKTPGSVVYLSFGSG------TGLPNEQ 302

  Fly   317 IIRAVARLK---QKVIW---KWENET--------LP------NQPPNMHIMKWLPQRDILCHPNV 361
            ::.....|:   |..||   |.||:.        ||      |:...:.|..|.||..||.|..:
plant   303 LLEIAFGLEGSGQNFIWVVSKNENQVGTGENEDWLPKGFEERNKGKGLIIRGWAPQVLILDHKAI 367

  Fly   362 KVFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVNTAALVE 401
            ..|::|.|...|.|....|:|:|..||..:||.|...|.:
plant   368 GGFVTHCGWNSTLEGIAAGLPMVTWPMGAEQFYNEKLLTK 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 94/430 (22%)
UGT73B4NP_179151.2 PLN03007 1..484 CDD:178584 94/430 (22%)
YjiC 7..465 CDD:224732 94/430 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.