DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36D1 and UGT2B15

DIOPT Version :9

Sequence 1:NP_001246082.2 Gene:Ugt36D1 / 35138 FlyBaseID:FBgn0032713 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001067.2 Gene:UGT2B15 / 7366 HGNCID:12546 Length:530 Species:Homo sapiens


Alignment Length:507 Identity:131/507 - (25%)
Similarity:241/507 - (47%) Gaps:42/507 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SHFHFFHPIMKGLAEAGHDVSVVSH------------------FPDKHPVAHYKDFPLTGMDKLT 86
            ||:.....|::.|.:.||:|:|::.                  :|......:.:|..|..:|:..
Human    34 SHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWI 98

  Fly    87 NSVDLKFFEKRTFYSHFQEFFLL----YDWGKQTCNLTLRSEALQQILRRPGRFDVIIMEQFNTD 147
            ..|     .|.||:|:|.:...|    ||:..:.|...:.::.|...|:. .:||||:.:..| .
Human    99 YGV-----SKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMKLQE-SKFDVILADALN-P 156

  Fly   148 CMMGVAHQLQAPVIALSSCVMMPWHYERMGAPLI--PSHIPALFMAQSQHMNFGGRLANWFSTHA 210
            |...:|.....|.: .|....:.:.:|:.|...:  ||::|.:....|..|.|..|:.|......
Human   157 CGELLAELFNIPFL-YSLRFSVGYTFEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIHMLY 220

  Fly   211 LNWMYKLLSVPAADAMVQYKFGHDVPSVGELVKNTSMFFVNQHYSLSGPKVTPPNVIELGGIHIQ 275
            .::.:::..:...|.......|... ::.|.:....|:.:..::....|:...|||..:||:|.:
Human   221 FDFWFQIYDLKKWDQFYSEVLGRPT-TLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCK 284

  Fly   276 KSKPLPADLQRILDNA-EEGVILISWGSMIRANSLSAAKRDGIIRAVARLKQKVIWKWENETLPN 339
            .:||||.:::..:.:: |.|:::.|.||||  :::|....:.|..|:|::.|||:|:::.:....
Human   285 PAKPLPKEMEEFVQSSGENGIVVFSLGSMI--SNMSEESANMIASALAQIPQKVLWRFDGKKPNT 347

  Fly   340 QPPNMHIMKWLPQRDILCHPNVKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVNTAALVERGM 404
            ...|..:.|||||.|:|.||..|.|::|||..|..||.|.|:|:|..|::.||..|.|.:..:|.
Human   348 LGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGA 412

  Fly   405 GTILNFEDIGENTVMRALKKAL-DKKFHDAAKVVSHSFHHRPQQALHTAIWWVEHVAHTGGAPLL 468
            ...::...:....::.|||..: |..:.:....:|...|.:|.:.|..|::|:|.|....||..|
Human   413 ALSVDIRTMSSRDLLNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHL 477

  Fly   469 KPSAVEMSRFVYYSLDVYAVLALVLGSIIASWVWLLRLC--CGSSAAQKTKK 518
            :.:|..::...|:||||.|.|...:.::|   ..:.:.|  |....|:|.||
Human   478 RVAAHNLTWIQYHSLDVIAFLLACVATVI---FIITKFCLFCFRKLAKKGKK 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36D1NP_001246082.2 egt 21..482 CDD:223071 118/467 (25%)
UGT2B15NP_001067.2 egt 8..508 CDD:223071 125/487 (26%)
UDPGT 24..518 CDD:278624 127/497 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150101
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.