DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and ATG26

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_013290.1 Gene:ATG26 / 850886 SGDID:S000004179 Length:1198 Species:Saccharomyces cerevisiae


Alignment Length:330 Identity:78/330 - (23%)
Similarity:130/330 - (39%) Gaps:72/330 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 RYDVILLEHFSNDCMAAVAHLLNAPVIALSSCAIMPWHYKRMGSPFINPIMPMNFLPYTDEMSLI 196
            ::| ||:|  |...|..: |:..|..|.......|||...|        ..|..|:  ..:....
Yeast   840 KFD-ILIE--SPSAMVGI-HITEALQIPYFRAFTMPWTRTR--------AYPHAFI--VPDQKRG 890

  Fly   197 DRLNNFFHFHTVNTLYNMITQPATDALIAERFGPGLPPINEIVKNTSLMLINQH-----YALTGP 256
            ...|...|....|..:..|:.......: |..|.|         .|:|.|:.|:     |.:: |
Yeast   891 GNYNYLTHVLFENVFWKGISGQVNKWRV-ETLGLG---------KTNLFLLQQNNVPFLYNVS-P 944

  Fly   257 RPYAPNV-----IEVGGL----QVGPIKPLPQHLLDLLDRSPN---GVIYISWGSMVNSNTLPSG 309
            ..:.|::     :.|.|.    .....|| |..|.:.:..:.:   .::||.:||:|.||.  ..
Yeast   945 TIFPPSIDFSEWVRVTGYWFLDDKSTFKP-PAELQEFISEARSKGKKLVYIGFGSIVVSNA--KE 1006

  Fly   310 KRSALFQSISQLKEYNFVMR-WKSLESLEDKQ--------PSNLYTF-----DWLPQRDLLCHPK 360
            ...||.:::.:...|..:.: |.  |.|.||.        |.|:...     |||       .|:
Yeast  1007 MTEALVEAVMEADVYCILNKGWS--ERLGDKAAKKTEVDLPRNILNIGNVPHDWL-------FPQ 1062

  Fly   361 IRAFISHGGLLGTTEA-IHCGVPMLVTPFYGDQFLNSGAVKQRGFGVIVDFRDFDSNHITRGLRI 424
            :.|.:.||| .|||.| :..|:|.::.||:||||..:|.|:..|.|:.:  :..::..:...|::
Yeast  1063 VDAAVHHGG-SGTTGASLRAGLPTVIKPFFGDQFFYAGRVEDIGVGIAL--KKLNAQTLADALKV 1124

  Fly   425 ILDKK 429
            ....|
Yeast  1125 ATTNK 1129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 78/330 (24%)
YjiC 38..461 CDD:224732 78/330 (24%)
ATG26NP_013290.1 GRAM 194..>239 CDD:214725
PH-GRAM1_AGT26 219..335 CDD:275402
PH-GRAM2_AGT26 581..673 CDD:275403
YjiC 739..1168 CDD:224732 78/330 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.