DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and UGT85A4

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_177950.1 Gene:UGT85A4 / 844162 AraportID:AT1G78270 Length:489 Species:Arabidopsis thaliana


Alignment Length:516 Identity:113/516 - (21%)
Similarity:192/516 - (37%) Gaps:163/516 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HPGKSHFDFFRPMFLALAE----RGHNISMYSYFPLEKPVANYTDY------------VFQGMPL 77
            :|.:.|.:   || |.||:    ||.:::..:           |||            ...|:| 
plant    19 YPAQGHIN---PM-LKLAKLLHARGFHVTFVN-----------TDYNHRRILQSRGPHALNGLP- 67

  Fly    78 LTDIVDLSNFESEWKPLGLPFKVPTYFMLHDWGLRSCKVALNSPLITQLLKSPIRYDVILLEHFS 142
                    :|..|..|.|||:.        |...:...:.|....|...| :|.: |:||..:..
plant    68 --------SFRFETIPDGLPWT--------DVDAKQDMLKLIDSTINNCL-APFK-DLILRLNSG 114

  Fly   143 ND-----CMAAVAHL---------LNAPVIAL----SSCAIMPWHYKRMGSPFINPIMPMNFLPY 189
            :|     |:.:.|.:         |..||:.|    ::..|:..||::        ::....:|.
plant   115 SDIPPVSCIISDASMSFTIDAAEELKIPVVLLWTNSATALILYLHYQK--------LIEKEIIPL 171

  Fly   190 TDEMSL-------ID--------RLNNFFHFHTVNTLYNMITQPATDALIAERFGPGLPPINEI- 238
            .|...|       ||        :|.:|..|.|..                   .|..|.|:.| 
plant   172 KDSSDLKKHLETEIDWIPSMKKIKLKDFPDFVTTT-------------------NPQDPMISFIL 217

  Fly   239 -----VKNTSLMLIN-----QHYALTGPRPYAPNVIEVGGLQV---------GPIKPLPQHL--- 281
                 :|..|.:.||     :|..|...|...|.:..||..|:         ..|:.|..:|   
plant   218 HVTGRIKRASAIFINTFEKLEHNVLLSLRSLLPQIYSVGPFQILENREIDKNSEIRKLGLNLWEE 282

  Fly   282 ----LDLLD-RSPNGVIYISWGSMVNSNTLPSGKRSALFQSISQL-KEYNFVMRWKSL------- 333
                ||.|| ::...|||:::||:   ..|.|.:.......:::. ||:.:|:|...:       
plant   283 ETESLDWLDTKAEKAVIYVNFGSL---TVLTSEQILEFAWGLARSGKEFLWVVRSGMVDGDDSIL 344

  Fly   334 --ESLEDKQPSNLYTFDWLPQRDLLCHPKIRAFISHGGLLGTTEAIHCGVPMLVTPFYGDQFLN- 395
              |.|.:.:...:....|..|..:|.||.|..|::|.|...|.|:::.||||:..||:.||..| 
plant   345 PAEFLSETKNRGMLIKGWCSQEKVLSHPAIGGFLTHCGWNSTLESLYAGVPMICWPFFADQLTNR 409

  Fly   396 SGAVKQRGFGVIVDFRDFDSNHITRGLRIILD----KKFAERV---RRSSEAFRQRPIPPI 449
            ....:..|.|:.:. .:.....:...::.::|    |:..|:|   ||.:|   :...||:
plant   410 KFCCEDWGIGMEIG-EEVKRERVETVVKELMDGEKGKRLREKVVEWRRLAE---EASAPPL 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 113/516 (22%)
YjiC 38..461 CDD:224732 111/507 (22%)
UGT85A4NP_177950.1 Glycosyltransferase_GTB-type 5..480 CDD:415824 113/516 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.