DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and UGT85A3

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_173655.2 Gene:UGT85A3 / 838845 AraportID:AT1G22380 Length:488 Species:Arabidopsis thaliana


Alignment Length:513 Identity:105/513 - (20%)
Similarity:176/513 - (34%) Gaps:173/513 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HPGKSHFDFFRPMFLALAERGHNI----SMYSYFP-LEKPVANYTDYVFQGMPLLTDIVDLSNFE 88
            :|.:.|.:....:...|..:|.::    ::|::.. |....||..|    |:|         :|:
plant    19 YPAQGHINPMMKVAKLLHVKGFHVTFVNTVYNHNRLLRSRGANALD----GLP---------SFQ 70

  Fly    89 SEWKPLGLP-------FKVPTYFMLHDWGLRSCKVALNSPLITQLLKSPIRYDV----ILLEHFS 142
            .|..|.|||       ..:|.   |.:...::|.|    |....|.:...|.||    .::...|
plant    71 FESIPDGLPETGVDATQDIPA---LSESTTKNCLV----PFKKLLQRIVTREDVPPVSCIVSDGS 128

  Fly   143 NDCMAAVAHLLNAPVI---ALSSCAIMPW-HYKRMGSPFINPIMPMNFL--PYTDE-MSLIDRLN 200
            ......||..|..|.|   ..|:|..|.: |:.......:.|:...:.|  .|.|. :..|..:|
plant   129 MSFTLDVAEELGVPEIHFWTTSACGFMAYLHFYLFIEKGLCPVKDASCLTKEYLDTVIDWIPSMN 193

  Fly   201 NF------FHFHTVN---TLYNMITQPATDALIAERFGPGLPPINEIVKNTSLMLIN-----QHY 251
            |.      ....|.|   .:.|.:.:.|..                 .|..|.:::|     :|.
plant   194 NVKLKDIPSFIRTTNPNDIMLNFVVREACR-----------------TKRASAIILNTFDDLEHD 241

  Fly   252 ALTGPRPYAPNVIEVGGLQVGPIKPLPQHLLD---------------------------LLDRSP 289
            .:...:...|.|..:|          |.|||.                           |..:|.
plant   242 IIQSMQSILPPVYPIG----------PLHLLVNREIEEDSEIGRMGSNLWKEETECLGWLNTKSR 296

  Fly   290 NGVIYISWGSMVNSNTLPSGKRSALFQSISQL-----------KEYNFVMRWKSL---------E 334
            |.|:|:::||:....|             :||           ||:.:|||..|:         |
plant   297 NSVVYVNFGSITIMTT-------------AQLLEFAWGLAATGKEFLWVMRPDSVAGEEAVIPKE 348

  Fly   335 SLEDKQPSNLYTFDWLPQRDLLCHPKIRAFISHGGLLGTTEAIHCGVPMLVTPFYGDQFLN---- 395
            .|.:.....:.| .|.||..:|.||.:..|::|.|...|.|::.|||||:..||:.:|..|    
plant   349 FLAETADRRMLT-SWCPQEKVLSHPAVGGFLTHCGWNSTLESLSCGVPMVCWPFFAEQQTNCKFS 412

  Fly   396 ----------SGAVKQRGFGVIVDFRDFDSNHITRGLRIILDKKFAERVRRSSEAFRQ 443
                      .|.||:.....:|              |.::|.:..:::|..:..:|:
plant   413 CDEWEVGIEIGGDVKRGEVEAVV--------------RELMDGEKGKKMREKAVEWRR 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 105/513 (20%)
YjiC 38..461 CDD:224732 103/504 (20%)
UGT85A3NP_173655.2 Glycosyltransferase_GTB_type 9..478 CDD:299143 105/513 (20%)
MGT 20..459 CDD:273616 105/512 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.