DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and UGT85A7

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_173652.1 Gene:UGT85A7 / 838841 AraportID:AT1G22340 Length:487 Species:Arabidopsis thaliana


Alignment Length:243 Identity:53/243 - (21%)
Similarity:107/243 - (44%) Gaps:49/243 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 KNTSLMLIN-----QHYALTGPRPYAPNVIEVGGL------QVGPIKPLPQ----------HLLD 283
            |..|.:::|     :|..:...:...|.|..:|.|      ::.....:.|          ..||
plant   225 KRASAIILNTFDELEHDVIQSMQSILPPVYSIGPLHLLVKEEINEASEIGQMGLNLWREEMECLD 289

  Fly   284 LLD-RSPNGVIYISWGSMVNSNTLPSGKRSALFQ--SISQLKEYNFVMRWKSL------------ 333
            .|| ::||.|:::::|.:    |:.|.|:...|.  ..:..||:.:|:|...:            
plant   290 WLDTKTPNSVLFVNFGCI----TVMSAKQLEEFAWGLAASRKEFLWVIRPNLVVGEAMVVLPQEF 350

  Fly   334 --ESLEDKQPSNLYTFDWLPQRDLLCHPKIRAFISHGGLLGTTEAIHCGVPMLVTPFYGDQFLN- 395
              |:::.:..::     |.||..:|.||.|..|::|.|...|.|::..||||:..|.:.:|..| 
plant   351 LAETIDRRMLAS-----WCPQEKVLSHPAIGGFLTHCGWNSTLESLAGGVPMICWPCFSEQPTNC 410

  Fly   396 SGAVKQRGFGVIVDFRDFDSNHITRGLRIILDKKFAERVRRSSEAFRQ 443
            .....:.|.|:.:. :|.....:...:|.::|.:..:::|..:|.:|:
plant   411 KFCCDEWGVGIEIG-KDVKREEVETVVRELMDGEKGKKLREKAEEWRR 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 53/243 (22%)
YjiC 38..461 CDD:224732 53/243 (22%)
UGT85A7NP_173652.1 Glycosyltransferase_GTB-type 12..481 CDD:385653 53/243 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.