DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and AT1G06000

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_563756.1 Gene:AT1G06000 / 837109 AraportID:AT1G06000 Length:435 Species:Arabidopsis thaliana


Alignment Length:442 Identity:99/442 - (22%)
Similarity:163/442 - (36%) Gaps:121/442 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 KP--LGLPF-----KVPTYFMLHDWGLRSCKVAL-----NSPLITQL--LKSPIRYDVILLEHFS 142
            ||  |.:||     .||...:.|...||...|.:     ||..:..|  |.||..:..::|...|
plant     8 KPHVLVIPFPQSGHMVPHLDLTHQILLRGATVTVLVTPKNSSYLDALRSLHSPEHFKTLILPFPS 72

  Fly   143 NDC------------MAAVAHLLNA--------------------PVIALSSCAIMPWHYKRMGS 175
            :.|            :.|:.|:.:|                    |...|.|..:.|| ..::..
plant    73 HPCIPSGVESLQQLPLEAIVHMFDALSRLHDPLVDFLSRQPPSDLPDAILGSSFLSPW-INKVAD 136

  Fly   176 PFINPIMPMNFLPYTDEMSLIDRLNNFFHFHTVNTL--------YNMITQPATDA--LIAERFGP 230
            .|  .|..::|||              .:.|:::.:        :|.:....|::  |:...| .
plant   137 AF--SIKSISFLP--------------INAHSISVMWAQEDRSFFNDLETATTESYGLVINSF-Y 184

  Fly   231 GLPPINEIVKNTSLMLINQHYALT-GP-RPYAPNVIEVGGLQVGPIKPLPQHLLDLLDRSP--NG 291
            .|.|  |.|:......:|.|...| || .|:...|...|...:.|.|     :...||..|  |.
plant   185 DLEP--EFVETVKTRFLNHHRIWTVGPLLPFKAGVDRGGQSSIPPAK-----VSAWLDSCPEDNS 242

  Fly   292 VIYISWGSMVNSNTLPSGKRSALFQSISQLKEYNFVMRW------KSLESL-----EDKQPS--- 342
            |:|:.:||.:.   |.:.:.:||..::.: ....|:  |      |.:.|.     ||..|:   
plant   243 VVYVGFGSQIR---LTAEQTAALAAALEK-SSVRFI--WAVRDAAKKVNSSDNSVEEDVIPAGFE 301

  Fly   343 ------NLYTFDWLPQRDLLCHPKIRAFISHGGLLGTTEAIHCGVPMLVTPFYGDQFLNSGAV-- 399
                  .|....|.||..:|.|..:.::::|.|.....|.:..||.:|..|...|.|.|:..:  
plant   302 ERVKEKGLVIRGWAPQTMILEHRAVGSYLTHLGWGSVLEGMVGGVMLLAWPMQADHFFNTTLIVD 366

  Fly   400 KQRGFGVIVDFRDF--DSNHITRGLRIILDKKFAERV------RRSSEAFRQ 443
            |.|....:.:.||.  ||:.:.|.|.....:...|||      .::.||.::
plant   367 KLRAAVRVGENRDSVPDSDKLARILAESAREDLPERVTLMKLREKAMEAIKE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 99/442 (22%)
YjiC 38..461 CDD:224732 99/442 (22%)
AT1G06000NP_563756.1 Glycosyltransferase_GTB-type 8..430 CDD:385653 99/442 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.