DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and UGT76E2

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_200767.1 Gene:UGT76E2 / 836078 AraportID:AT5G59590 Length:449 Species:Arabidopsis thaliana


Alignment Length:502 Identity:113/502 - (22%)
Similarity:190/502 - (37%) Gaps:147/502 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PGKSHFDFFRPMFLALAERGHNISMYSYFPLEKPVA---NYTDYVFQGMP-LLTDIVDLSNFESE 90
            |.:.|......:..||..:|.:|::  .......|:   :::|:.|..:| .||        ||:
plant    17 PAQGHVTPMMQLGKALHSKGFSITV--VLTQSNRVSSSKDFSDFHFLTIPGSLT--------ESD 71

  Fly    91 WKPLGLPFKVPTYFMLH-----DWGLRSCKVALNSPLITQLLKSPIRYDV--ILLEHFSNDCMAA 148
            .:.||     |..|:|.     :...:.|        |.|||......|:  ::.:.:.....||
plant    72 LQNLG-----PQKFVLKLNQICEASFKQC--------IGQLLHEQCNNDIACVVYDEYMYFSHAA 123

  Fly   149 VAHLLNAPVIALSSCAIMPWHYKRMGSPFINPIMPMNFLPYTDEMSLIDRLNNFFHFHTVNTLYN 213
            |.. ...|.:..|:.:         .:.|:.             .|::.|:|      ..:.|.:
plant   124 VKE-FQLPSVVFSTTS---------ATAFVC-------------RSVLSRVN------AESFLID 159

  Fly   214 MITQPATDALIAERFGPGLPPI--------------------NEIV--KNTSLMLINQHYALTGP 256
            | ..|.|.    ::..|||.|:                    :|.|  :..|.::||....|...
plant   160 M-KDPETQ----DKVFPGLHPLRYKDLPTSVFGPIESTLKVYSETVNTRTASAVIINSASCLESS 219

  Fly   257 RPYAPNVIEVGGLQ------VGPIKPL------PQHLLDLLDRS---------PNGVIYISWGSM 300
                    .:..||      |.||.||      |..||: .|||         .|.|||||.||:
plant   220 --------SLARLQQQLQVPVYPIGPLHITASAPSSLLE-EDRSCVEWLNKQKSNSVIYISLGSL 275

  Fly   301 VNSNTLPSGKRSALFQSISQLKEYNFVMRWKSLESLE--DKQPSNL--------YTFDWLPQRDL 355
            ...:|....:.:....:.:|  .:.:|:|..|:...|  :..|...        |...|.||.::
plant   276 ALMDTKDMLEMAWGLSNSNQ--PFLWVVRPGSIPGSEWTESLPEEFNRLVSERGYIVKWAPQMEV 338

  Fly   356 LCHPKIRAFISHGGLLGTTEAIHCGVPMLVTPFYGDQFLNSGAVKQRGFGVIVDFR-DFDSNHIT 419
            |.||.:..|.||.|...|.|:|..||||:..||.|||.:|:..: :|.:.:.|... |.|...:.
plant   339 LRHPAVGGFWSHCGWNSTVESIGEGVPMICRPFTGDQKVNARYL-ERVWRIGVQLEGDLDKETVE 402

  Fly   420 RGLR-IILDKKFAERVRRSSEAFRQRPIPPIKLATWWIEHVIKYGGA 465
            |.:. :::|::.||..:|:.:...:            ||..::.||:
plant   403 RAVEWLLVDEEGAEMRKRAIDLKEK------------IETSVRSGGS 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 113/502 (23%)
YjiC 38..461 CDD:224732 109/488 (22%)
UGT76E2NP_200767.1 Glycosyltransferase_GTB-type 1..449 CDD:415824 113/502 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.