DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and AT5G37950

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_198611.1 Gene:AT5G37950 / 833774 AraportID:AT5G37950 Length:351 Species:Arabidopsis thaliana


Alignment Length:403 Identity:91/403 - (22%)
Similarity:137/403 - (33%) Gaps:131/403 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RGHNISMYSY------FPLEKPVANYTDYVFQGMPLLTDIVDLSNFESEWKPLGLPFKVPTYFML 106
            |.|::..:|.      |....|..:..|:.|..:|......||       |.||     |.:|::
plant     6 RAHSLKGFSITVAQTKFNYLNPSKDLADFQFITIPESLPASDL-------KTLG-----PIWFII 58

  Fly   107 HDWGL-RSCKVALNSPLITQLLKSPIRYDVILLEHFSNDCMAAVAHLLNAPVIALSS-------- 162
            .   | :.|:::....|...||:.......::.:.|.....|| |...|.|.:..|:        
plant    59 K---LNKECEISFKKCLGQFLLQQQEEIACVIYDEFMYFAEAA-AKEFNLPKVIFSTENATAFAC 119

  Fly   163 ----CAIMPWHYKRMGSPFINPIMPMNFLPYTD----EMSLIDRLNNFFHFHTVNTLYNMITQPA 219
                |.:    |.:.|           ..|.|:    |..|:..|      |.:.  |..:...|
plant   120 RSAMCKL----YAKDG-----------IAPLTEGCGREEELVPEL------HPLR--YKDLPTSA 161

  Fly   220 TDALIAERFGPGLPPINEIVKNT------SLMLINQHYALTGPRPYAPNVIEVGGLQ-------- 270
                    |.|....: |:.|::      |.|:||           ..:.:|:..|:        
plant   162 --------FAPVEASV-EVFKSSCEKGTASSMIIN-----------TVSCLEISSLEWLQQELKI 206

  Fly   271 -VGPIKPL-------PQHLLD--------LLDRSPNGVIYISWGSMVNSNTLPSGKRSALFQSIS 319
             :.||.||       |..|||        |..:.|:.|||||.||.    ||...|.  :.:..|
plant   207 PIYPIGPLYMVSSAPPTSLLDENESCIDWLNKQKPSSVIYISLGSF----TLLETKE--VLEMAS 265

  Fly   320 QLKEYNFVMRWK-----------SLESLEDKQ--PSNLYTFDWLPQRDLLCHPKIRAFISHGGLL 371
            .|...|....|.           |.|.|....  |...|...|..|:.:|.|..:.||.||.|..
plant   266 GLVSSNQYFLWAIRPGSILGSELSNEELFSMMEIPDRGYIVKWATQKQVLAHAAVGAFWSHCGWN 330

  Fly   372 GTTEAIHCGVPML 384
            .|.|:|..|:|::
plant   331 STLESIGEGIPIV 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 91/403 (23%)
YjiC 38..461 CDD:224732 91/403 (23%)
AT5G37950NP_198611.1 Glycosyltransferase_GTB_type 1..343 CDD:299143 91/401 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.