DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and UGT78D2

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_197207.1 Gene:UGT78D2 / 831568 AraportID:AT5G17050 Length:460 Species:Arabidopsis thaliana


Alignment Length:217 Identity:61/217 - (28%)
Similarity:93/217 - (42%) Gaps:54/217 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 LQVGPIKPLPQHLLDLLD-----------RSPNGVIYISWGSMVNSNTLPSGKRSALFQSISQLK 322
            |.:||:..|...|..|:.           ||...|.|||:|:::   |.|.|:.:|:.:.:...|
plant   245 LNIGPLGLLSSTLQQLVQDPHGCLAWMEKRSSGSVAYISFGTVM---TPPPGELAAIAEGLESSK 306

  Fly   323 -EYNFVMRWKSLESLE----DKQPSNLYTFDWLPQRDLLCHPKIRAFISHGGLLGTTEAIHCGVP 382
             .:.:.::.|||..|.    |:.........|.||.:||.|.....|::|.|.....|::..|||
plant   307 VPFVWSLKEKSLVQLPKGFLDRTREQGIVVPWAPQVELLKHEATGVFVTHCGWNSVLESVSGGVP 371

  Fly   383 MLVTPFYGDQFLNSGAVK---QRGFGVI--VDFRDFDSNHITRGLRIILDKKF-----------A 431
            |:..||:|||.||..||:   :.|..:|  |..:|        |....|||..           |
plant   372 MICRPFFGDQRLNGRAVEVVWEIGMTIINGVFTKD--------GFEKCLDKVLVQDDGKKMKCNA 428

  Fly   432 ERVR-----------RSSEAFR 442
            ::::           ||||.||
plant   429 KKLKELAYEAVSSKGRSSENFR 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 61/217 (28%)
YjiC 38..461 CDD:224732 61/217 (28%)
UGT78D2NP_197207.1 GT1_Gtf-like 12..438 CDD:340817 55/203 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.