DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and AT5G05900

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_196209.1 Gene:AT5G05900 / 830475 AraportID:AT5G05900 Length:450 Species:Arabidopsis thaliana


Alignment Length:341 Identity:78/341 - (22%)
Similarity:128/341 - (37%) Gaps:107/341 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 MITQPATDALIAERFGPGLPPINEIVKNT-SLMLINQHYALTGPR--PYAP-NVIEVGGLQVGPI 274
            :.|||     :|:.|  .||   .:|.|| .:.....|:.|...|  .|.| ...|.|...|...
plant   121 IFTQP-----VAQSF--NLP---RLVLNTYKVSFFRDHFVLPQLRREMYLPLQDSEQGDDPVEEF 175

  Fly   275 KPL-PQHLLDLLD-----------------RSPNGVIYISWGSMVNSNTL--------------- 306
            .|| .:.||.:||                 ::.:|:|::|....::.::|               
plant   176 PPLRKKDLLQILDQESEQLDSYSNMILETTKASSGLIFVSTCEELDQDSLSQAREDYQVPIFTIG 240

  Fly   307 PS-----GKRSALFQ-----------------------SISQLKEYNFV-MRW------------ 330
            ||     |..|:||.                       |||.:.|..|: :.|            
plant   241 PSHSYFPGSSSSLFTVDETCIPWLDKQEDKSVIYVSFGSISTIGEAEFMEIAWALRNSDQPFLWV 305

  Fly   331 ----------KSLESLEDKQPSNLYTFDWLPQRDLLCHPKIRAFISHGGLLGTTEAIHCGVPMLV 385
                      :.:|.|.:|..    ..:|.||:::|.|..|..|::|.|...|.|::..||||:.
plant   306 VRGGSVVHGAEWIEQLHEKGK----IVNWAPQQEVLKHQAIGGFLTHNGWNSTVESVFEGVPMIC 366

  Fly   386 TPFYGDQFLNSGAVKQRGF-GVIVDFRDFDSNHITRGLRIILDKKFAERVRRSSEAFRQ---RPI 446
            .||..||.||:..|..... |:.::.| .:.|.|...:|.:..:...:.:|...|..::   |.:
plant   367 MPFVWDQLLNARFVSDVWMVGLHLEGR-IERNVIEGMIRRLFSETEGKAIRERMEILKENVGRSV 430

  Fly   447 PPIKLATWWIEHVIKY 462
            .|...|...::|:|.|
plant   431 KPKGSAYRSLQHLIDY 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 78/341 (23%)
YjiC 38..461 CDD:224732 76/338 (22%)
AT5G05900NP_196209.1 Glycosyltransferase_GTB_type 2..447 CDD:299143 78/341 (23%)
YjiC 8..436 CDD:224732 74/329 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.