DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and AT5G05890

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_196208.1 Gene:AT5G05890 / 830474 AraportID:AT5G05890 Length:455 Species:Arabidopsis thaliana


Alignment Length:418 Identity:84/418 - (20%)
Similarity:154/418 - (36%) Gaps:117/418 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SCKVALNSPLITQLLKSPIRYDVILLEHFSNDCMAAVAHLLNAPVIALSSCA-IMPWHYKRMGSP 176
            ||.:|.:..:.||.:...::..:::|..|:               ::...|. ::|...:.:..|
plant   112 SCLIADSGWMFTQPIAQSLKLPILVLSVFT---------------VSFFRCQFVLPKLRREVYLP 161

  Fly   177 F-----------INPIMPMNFL-----------PYTDEMSLIDRLNNFFHFHTVNTL-YNMITQP 218
            .           ..|:...:.:           |:.|::..:.:.::...|.:...| ::.::|.
plant   162 LQDSEQEDLVQEFPPLRKKDIVRILDVETDILDPFLDKVLQMTKASSGLIFMSCEELDHDSVSQA 226

  Fly   219 ATDALIAERFGPGLPPINEIVKNTSLMLINQHYALTGPRPYAPNVIEVGGLQVGPIKPLPQHLLD 283
            ..|..|         ||..|..:.|      |:..|......|:                :..:.
plant   227 REDFKI---------PIFGIGPSHS------HFPATSSSLSTPD----------------ETCIP 260

  Fly   284 LLDRSPN-GVIYISWGSMVNSNTLPSGKRSALFQSISQLKE----YNFVMRWKSL---------- 333
            .||:..: .|||:|:||:|..:      .|.|.:....|:.    :..|:|..|:          
plant   261 WLDKQEDKSVIYVSYGSIVTIS------ESDLIEIAWGLRNSDQPFLLVVRVGSVRGREWIETIP 319

  Fly   334 ESLEDKQPSNLYTFDWLPQRDLLCHPKIRAFISHGGLLGTTEAIHCGVPMLVTPFYGDQFLNSGA 398
            |.:.:|.........|.||:|:|.|..|..|::|.|...|.|::...|||:..||..||.||:..
plant   320 EEIMEKLNEKGKIVKWAPQQDVLKHRAIGGFLTHNGWSSTVESVCEAVPMICLPFRWDQMLNARF 384

  Fly   399 VKQRGF-GVIVDFRDFDSNHITRGLRIILDKKFAERVRRSSEAFRQRPIPPIKLATWWIEHVIKY 462
            |..... |:.::.| .:.|.|...:|.:|       |....||.|:|           |||:.:.
plant   385 VSDVWMVGINLEDR-VERNEIEGAIRRLL-------VEPEGEAIRER-----------IEHLKEK 430

  Fly   463 GGAPHIQSEARHINWIVYNSIDVLLFWL 490
            .|....|      |...|.|:..|:.::
plant   431 VGRSFQQ------NGSAYQSLQNLIDYI 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 83/413 (20%)
YjiC 38..461 CDD:224732 78/387 (20%)
AT5G05890NP_196208.1 Glycosyltransferase_GTB-type 2..455 CDD:385653 84/418 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.