DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and AT5G05880

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_196207.1 Gene:AT5G05880 / 830473 AraportID:AT5G05880 Length:451 Species:Arabidopsis thaliana


Alignment Length:448 Identity:103/448 - (22%)
Similarity:168/448 - (37%) Gaps:126/448 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 TYFMLHDWGL-----RSCKVALNSPLITQLLKSPIRYDVILLEHFSNDCMAAVAHLLNAPVIALS 161
            |:..:.| ||     |:..|.|...|:.|..:||:|           :|:..:..........: 
plant    56 TFIQIQD-GLSETETRTRDVKLLITLLNQNCESPVR-----------ECLRKLLQSAKEEKQRI- 107

  Fly   162 SCAI--MPWHYKRMGSPFINPIMPMNFLPYTDEMSLIDRLNNFFHFHTV-NTLYNMITQPATDAL 223
            ||.|  ..|.:.:..:..:| :|.:.|..|.         .:||..|.| ..|...:..|..|  
plant   108 SCLINDSGWIFTQHLAKSLN-LMRLAFNTYK---------ISFFRSHFVLPQLRREMFLPLQD-- 160

  Fly   224 IAERFGP--GLPPINEIVKNTSLMLINQHYALTGPRPYAPNVIEVGGLQVG-------------- 272
             :|:..|  ..||:    :...|:.|.:..::.|. .|:..::|......|              
plant   161 -SEQDDPVEKFPPL----RKKDLLRILEADSVQGD-SYSDMILEKTKASSGLIFMSCEELDQDSL 219

  Fly   273 ---------PIKPL-PQH----------------LLDLLDRSPN-GVIYISWGSMVNSNT----- 305
                     ||..: |.|                .:..|||..: .|||:|.||:|..|.     
plant   220 SQSREDFKVPIFAIGPSHSHFPASSSSLFTPDETCIPWLDRQEDKSVIYVSIGSLVTINETELME 284

  Fly   306 ----LPSGKRSALF----------QSISQLKEYNFVMRWKSLESLEDKQPSNLYTFDWLPQRDLL 356
                |.:..:..|:          :.|..:.|| |:.|      |.:|..    ...|.||:::|
plant   285 IAWGLSNSDQPFLWVVRVGSVNGTEWIEAIPEY-FIKR------LNEKGK----IVKWAPQQEVL 338

  Fly   357 CHPKIRAFISHGGLLGTTEAIHCGVPMLVTPFYGDQFLNSGAVKQRGF-GVIVDFRDFDSNHITR 420
            .|..|..|::|.|...|.|::..||||:..||..||.||:..|..... |:.::.| .:.:.|.|
plant   339 KHRAIGGFLTHNGWNSTVESVCEGVPMICLPFRWDQLLNARFVSDVWMVGIHLEGR-IERDEIER 402

  Fly   421 GLRIILDKKFAERVRRSSEAFRQRPIPPIKLATWWIEHVIKYGGAPHIQSEARHINWI 478
            .:|.:|       :....||.|:|    |:|....:...:|..|:.: ||....||:|
plant   403 AIRRLL-------LETEGEAIRER----IQLLKEKVGRSVKQNGSAY-QSLQNLINYI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 103/448 (23%)
YjiC 38..461 CDD:224732 96/429 (22%)
AT5G05880NP_196207.1 Glycosyltransferase_GTB-type 2..451 CDD:385653 103/448 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.