DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and UGT76C1

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_196206.1 Gene:UGT76C1 / 830472 AraportID:AT5G05870 Length:464 Species:Arabidopsis thaliana


Alignment Length:260 Identity:63/260 - (24%)
Similarity:101/260 - (38%) Gaps:75/260 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 PIKPL-PQHLLDL-----------------LD-RSPNGVIYISWGSMVNSNTLPSGKRSALFQSI 318
            ||.|: |.|:.|:                 || |....|:|:|.||:.:.|      .|...:..
plant   234 PIFPIGPFHIHDVPASSSSLLEPDQSCIPWLDMRETRSVVYVSLGSIASLN------ESDFLEIA 292

  Fly   319 SQLKEYNFVMRW-------------KSL-----ESLEDKQPSNLYTFDWLPQRDLLCHPKIRAFI 365
            ..|:..|....|             :||     |||:.|..    ...|.||.|:|.|.....|:
plant   293 CGLRNTNQSFLWVVRPGSVHGRDWIESLPSGFMESLDGKGK----IVRWAPQLDVLAHRATGGFL 353

  Fly   366 SHGGLLGTTEAIHCGVPMLVTPFYGDQFLNSGAVKQ-RGFGVIVDFRDFDSNHITRG-LRIILDK 428
            :|.|...|.|:|..||||:..|...|||:|:..:.: ...|:.::.| .:...|.|. :|::::.
plant   354 THNGWNSTLESICEGVPMICLPCKWDQFVNARFISEVWRVGIHLEGR-IERREIERAVIRLMVES 417

  Fly   429 KFAERVRRSSEAFRQRPIPPIKLATWWIEHVIKYGGAPHIQSEARHINWIVYNSIDVLLFWLGIL 493
            | .|.:|...:..|..           :...:|.||:.             |.|:|.|:..:.|:
plant   418 K-GEEIRGRIKVLRDE-----------VRRSVKQGGSS-------------YRSLDELVDRISII 457

  Fly   494  493
            plant   458  457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 61/252 (24%)
YjiC 38..461 CDD:224732 55/226 (24%)
UGT76C1NP_196206.1 Glycosyltransferase_GTB_type 2..451 CDD:299143 61/252 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.