DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and GT72B1

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_192016.1 Gene:GT72B1 / 827912 AraportID:AT4G01070 Length:480 Species:Arabidopsis thaliana


Alignment Length:282 Identity:65/282 - (23%)
Similarity:100/282 - (35%) Gaps:86/282 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 IMPMNFLPYTDEMSLIDRLNNFFHF----HTVNTLYNMITQPATDALIAERFGPGLPPI------ 235
            :.|..|.|.|..:     |:.|.|.    .||:..:..:|:|.        ..||..|:      
plant   132 VPPYIFYPTTANV-----LSFFLHLPKLDETVSCEFRELTEPL--------MLPGCVPVAGKDFL 183

  Fly   236 -----------NEIVKNTSL------MLINQHYALTGPRPYAPNVIEVGGLQVGPIKPL------ 277
                       ..::.||..      :|:|..:.|   .|.|...::..||...|:.|:      
plant   184 DPAQDRKDDAYKWLLHNTKRYKEAEGILVNTFFEL---EPNAIKALQEPGLDKPPVYPVGPLVNI 245

  Fly   278 ---------PQHLLDLLDRSPNG-VIYISWGS-------MVNSNTL---------------PSG- 309
                     ....|..||..|.| |:|:|:||       .:|...|               ||| 
plant   246 GKQEAKQTEESECLKWLDNQPLGSVLYVSFGSGGTLTCEQLNELALGLADSEQRFLWVIRSPSGI 310

  Fly   310 KRSALFQSISQLKEYNFVMRWKSLESLEDKQPSNLYTFDWLPQRDLLCHPKIRAFISHGGLLGTT 374
            ..|:.|.|.||.....|:    ....||..:........|.||..:|.||....|::|.|...|.
plant   311 ANSSYFDSHSQTDPLTFL----PPGFLERTKKRGFVIPFWAPQAQVLAHPSTGGFLTHCGWNSTL 371

  Fly   375 EAIHCGVPMLVTPFYGDQFLNS 396
            |::..|:|::..|.|.:|.:|:
plant   372 ESVVSGIPLIAWPLYAEQKMNA 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 65/282 (23%)
YjiC 38..461 CDD:224732 65/282 (23%)
GT72B1NP_192016.1 Glycosyltransferase_GTB_type 7..462 CDD:299143 65/282 (23%)
MGT 15..454 CDD:273616 65/282 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.