DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36F1 and UGT84A3

DIOPT Version :9

Sequence 1:NP_609909.1 Gene:Ugt36F1 / 35137 FlyBaseID:FBgn0027074 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_193284.1 Gene:UGT84A3 / 827221 AraportID:AT4G15490 Length:479 Species:Arabidopsis thaliana


Alignment Length:451 Identity:98/451 - (21%)
Similarity:160/451 - (35%) Gaps:142/451 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PNDAAHILGLFQHPGKSHFDFFRPMFLALAERGHNISMYSYFPLEKPVANYTDYVFQGMPLLTDI 81
            |:...|:: |...||:.|.:....:...:|.:|   .:.::...|||..       :.|.....|
plant     3 PSRHTHVM-LVSFPGQGHVNPLLRLGKLIASKG---LLVTFVTTEKPWG-------KKMRQANKI 56

  Fly    82 VDLSNFESEWKPLGLPFKVPTYFM-------------------LHDWGLRSCKVALNSPLITQLL 127
            .|     ...||:||.|....:|.                   |...|.:..|     .|:.:..
plant    57 QD-----GVLKPVGLGFIRFEFFSDGFADDDEKRFDFDAFRPHLEAVGKQEIK-----NLVKRYN 111

  Fly   128 KSPIRYDVILLEHFSNDCMAAVAHLLNAP--VIALSSCAIMP----WHYKRMGSPFIN------- 179
            |.|:   ..|:.:.....:..||..|:.|  |:.:.|||.:.    :|::.:..|...       
plant   112 KEPV---TCLINNAFVPWVCDVAEELHIPSAVLWVQSCACLTAYYYYHHRLVKFPTKTEPDISVE 173

  Fly   180 -PIMPM-------NFL----PYT-------DEMSLIDRLNNFFHFHTVNTLYNMITQPATDALIA 225
             |.:|:       :||    |||       |::...:...:|:.|                    
plant   174 IPCLPLLKHDEIPSFLHPSSPYTAFGDIILDQLKRFENHKSFYLF-------------------- 218

  Fly   226 ERFGPGLPPINEIVKNTSLMLINQHYALTGPRPYAPNVIEVGGLQVGPIKPLPQHL--------- 281
                  :....|:.|:     |..|.:...|:.    :|.    .|||:..:.|.|         
plant   219 ------IDTFRELEKD-----IMDHMSQLCPQA----IIS----PVGPLFKMAQTLSSDVKGDIS 264

  Fly   282 ------LDLLD-RSPNGVIYISWGSMVN--SNTLPSGKRSALFQSISQL------KEYNFVMRWK 331
                  ::.|| |.|:.|:|||:|::.|  ...:.......|...:|.|      .|..||....
plant   265 EPASDCMEWLDSREPSSVVYISFGTIANLKQEQMEEIAHGVLSSGLSVLWVVRPPMEGTFVEPHV 329

  Fly   332 SLESLEDKQPSNLYTFDWLPQRDLLCHPKIRAFISHGGLLGTTEAIHCGVPMLVTPFYGDQ 392
            ....||:|..    ..:|.||..:|.||.|..|:||.|...|.||:..|||::..|.:|||
plant   330 LPRELEEKGK----IVEWCPQERVLAHPAIACFLSHCGWNSTMEALTAGVPVVCFPQWGDQ 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36F1NP_609909.1 egt 19..487 CDD:223071 97/449 (22%)
YjiC 38..461 CDD:224732 92/430 (21%)
UGT84A3NP_193284.1 PLN02555 1..479 CDD:178170 98/451 (22%)
YjiC 8..450 CDD:224732 97/446 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.